Danish

Uniprot ID: P02240

Protein: Leghemoglobin-2
Organism: European yellow lupine (Lupinus luteus)
Length: 154
Sequence:

MGALTESQAALVKSSWEEFNANIPKHTHRFFILVLEIAPAAKDLFSFLKGTSEVPQNNPELQAHAGKVFKLVYEAAIQLQVTGVVVTDATLKNLGSVHVSKGVADAHFPVVKEAILKTIKEVVGAKWSEELNSAWTIAYDELAIVIKKEMNDAA

Number of chains: 17

PDB ID: 1gdj , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 2gdm , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1gdi , Chain A
Resolution	1.80 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1gdk , Chain A
Resolution	1.80 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1gdl , Chain A
Resolution	1.80 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1lh1 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1lh2 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1lh3 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1lh5 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1lh6 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1lh7 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 2lh1 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 2lh2 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 2lh3 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 2lh5 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 2lh6 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 2lh7 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	1-153 (2-154), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB