Danish
Uniprot ID:  P04032
  • Protein: Cytochrome c-553
  • Organism: Desulfovibrio vulgaris (Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough))
  • Length: 103
  • Sequence:
    • MKRVLLLSSLCAALSFGLAVSGVAADGAALYKSCIGCHGADGSKAAMGSAKPVKGQGAEELYKKMKGYADGSYGGERKAMMTNAVKKYSDEELKALADYMSKL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001dvh , Chain A 
Residue indices (Uniprot), coverage 1-79 (25-103), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A24
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001dwl , Chain B 
Residue indices (Uniprot), coverage 1-79 (25-103), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A24
Sequence identity to UniProt 1.0000
auth_asym_id B
Structural gaps Exists
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001e08 , Chain C 
Residue indices (Uniprot), coverage 2-79 (26-103), 0.76
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A25
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00002dvh , Chain A 
Residue indices (Uniprot), coverage 1-79 (25-103), 0.77
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y88A
Insertions None
Deletions M1-A24
Sequence identity to UniProt 0.9873
auth_asym_id A
label_asym_ids of heme B
Available structure PDB