Danish

Uniprot ID: P04032

Protein: Cytochrome c-553
Organism: Desulfovibrio vulgaris (Nitratidesulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / CCUG 34227 / NCIMB 8303 / VKM B-1760 / Hildenborough))
Length: 103
Sequence:

MKRVLLLSSLCAALSFGLAVSGVAADGAALYKSCIGCHGADGSKAAMGSAKPVKGQGAEELYKKMKGYADGSYGGERKAMMTNAVKKYSDEELKALADYMSKL

Number of chains: 4

PDB ID: 1dvh , Chain A
Residue indices (Uniprot), coverage	1-79 (25-103), 0.77
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1dwl , Chain B
Residue indices (Uniprot), coverage	1-79 (25-103), 0.77
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 1e08 , Chain C
Residue indices (Uniprot), coverage	2-79 (26-103), 0.76
auth_asym_id	E
label_asym_ids of heme	O
Available structure	PDB

PDB ID: 2dvh , Chain A
Residue indices (Uniprot), coverage	1-79 (25-103), 0.77
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB