- Protein: Cytochrome c-552
- Organism:
- Length: 131
- Sequence:
QADGAKIYAQCAGCHQQNGQGIPGAFPPLAGHVAEILAKEGGREYLILVLLYGLQGQIEVKGMKYNGVMSSFAQLKDEEIAAVLNHIATAWGDAKKVKGFKPFTAEEVKKLRAKKLTPQQVLAERKKLGLK
| Resolution | 1.28 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-131 (1-131), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.97 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-131 (3-131), 0.98 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 3-131 (1-131), 1.00 |
|---|---|
| Difference from Uniprot sequence | cloning artifact |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |