Danish
Uniprot ID:  P04166
  • Protein: Cytochrome b5 type B
  • Organism: Rat (Rattus norvegicus)
  • Length: 146
  • Sequence:
    • MATPEASGSGRNGQGSDPAVTYYRLEEVAKRNTAEETWMVIHGRVYDITRFLSEHPGGEEVLLEQAGADATESFEDVGHSPDAREMLKQYYIGDVHPNDLKPKDGDKDPSKNNSCQSSWAYWIVPIVGAILIGFLYRHFWADSKSS
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  24
PDB ID:  pdb_00004hil , Chain A 
Resolution 1.25 Å
Residue indices (Uniprot), coverage 2-86 (17-102), 0.60
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) S146A
Insertions None
Deletions M1-S16, K103-S145
Sequence identity to UniProt 0.9885
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00004hil , Chain B 
Resolution 1.25 Å
Residue indices (Uniprot), coverage 4-84 (17-102), 0.60
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) S146A
Insertions None
Deletions M1-S16, K103-S145
Sequence identity to UniProt 0.9885
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001eue , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-86 (17-102), 0.59
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V61I, V77I
Insertions None
Deletions M1-S16, K103-S146
Sequence identity to UniProt 0.9767
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001eue , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-86 (17-102), 0.59
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V61I, V77I
Insertions None
Deletions M1-S16, K103-S146
Sequence identity to UniProt 0.9767
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001awp , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-86 (12-103), 0.63
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) N12D, V61L, V77L
Insertions None
Deletions M1-R11, D104-S146
Sequence identity to UniProt 0.9674
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001awp , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-86 (12-103), 0.63
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) N12D, V61L, V77L
Insertions None
Deletions M1-R11, D104-S146
Sequence identity to UniProt 0.9674
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001icc , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-87 (17-103), 0.60
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A34S, I48L, L63R
Insertions None
Deletions M1-S16, D104-S146
Sequence identity to UniProt 0.9655
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001icc , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-87 (17-103), 0.60
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A34S, I48L, L63R
Insertions None
Deletions M1-S16, D104-S146
Sequence identity to UniProt 0.9655
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001icc , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 4-86 (17-103), 0.60
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A34S, I48L, L63R
Insertions None
Deletions M1-S16, D104-S146
Sequence identity to UniProt 0.9655
auth_asym_id C
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00001icc , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-87 (17-103), 0.60
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A34S, I48L, L63R
Insertions None
Deletions M1-S16, D104-S146
Sequence identity to UniProt 0.9655
auth_asym_id D
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00001lj0 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage -1-87 (12-103), 0.63
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A34S, I41L, I48L, L63R, L87S
Insertions None
Deletions M1-R11, D104-S146
Sequence identity to UniProt 0.9457
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001lj0 , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage -1-87 (12-103), 0.63
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A34S, I41L, I48L, L63R, L87S
Insertions None
Deletions M1-R11, D104-S146
Sequence identity to UniProt 0.9457
auth_asym_id B
label_asym_ids of heme H ,  H
Available structure PDB
PDB ID:  pdb_00001lj0 , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage -1-87 (12-103), 0.63
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A34S, I41L, I48L, L63R, L87S
Insertions None
Deletions M1-R11, D104-S146
Sequence identity to UniProt 0.9457
auth_asym_id B
label_asym_ids of heme H ,  H
Available structure PDB
PDB ID:  pdb_00001lj0 , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage -1-86 (12-103), 0.63
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A34S, I41L, I48L, L63R, L87S
Insertions None
Deletions M1-R11, D104-S146
Sequence identity to UniProt 0.9457
auth_asym_id C
label_asym_ids of heme I ,  I
Available structure PDB
PDB ID:  pdb_00001lj0 , Chain C 
Resolution 2.00 Å
Residue indices (Uniprot), coverage -1-86 (12-103), 0.63
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A34S, I41L, I48L, L63R, L87S
Insertions None
Deletions M1-R11, D104-S146
Sequence identity to UniProt 0.9457
auth_asym_id C
label_asym_ids of heme I ,  I
Available structure PDB
PDB ID:  pdb_00001lj0 , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 2-87 (12-103), 0.63
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A34S, I41L, I48L, L63R, L87S
Insertions None
Deletions M1-R11, D104-S146
Sequence identity to UniProt 0.9457
auth_asym_id D
label_asym_ids of heme K ,  K
Available structure PDB
PDB ID:  pdb_00001lj0 , Chain D 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 2-87 (12-103), 0.63
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) A34S, I41L, I48L, L63R, L87S
Insertions None
Deletions M1-R11, D104-S146
Sequence identity to UniProt 0.9457
auth_asym_id D
label_asym_ids of heme K ,  K
Available structure PDB
PDB ID:  pdb_00003mus , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 2-86 (17-102), 0.60
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) S146A
Insertions None
Deletions M1-S16, K103-S145
Sequence identity to UniProt 0.9885
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003mus , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-87 (17-102), 0.60
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) S146A
Insertions None
Deletions M1-S16, K103-S145
Sequence identity to UniProt 0.9885
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00002i89 , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage -3-87 (12-103), 0.64
Difference from Uniprot sequence cloning artifact:engineered mutation
Mutations (UniProt numbering) R31H, A34S, E36S, I41L, I48L, L63R, L87S
Insertions None
Deletions A2-R11, D104-S146
Sequence identity to UniProt 0.9247
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002i89 , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage -3-87 (12-103), 0.64
Difference from Uniprot sequence cloning artifact:engineered mutation
Mutations (UniProt numbering) R31H, A34S, E36S, I41L, I48L, L63R, L87S
Insertions None
Deletions A2-R11, D104-S146
Sequence identity to UniProt 0.9247
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00002i89 , Chain C 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 2-86 (12-103), 0.64
Difference from Uniprot sequence cloning artifact:engineered mutation
Mutations (UniProt numbering) R31H, A34S, E36S, I41L, I48L, L63R, L87S
Insertions None
Deletions A2-R11, D104-S146
Sequence identity to UniProt 0.9247
auth_asym_id C
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00002i89 , Chain D 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 3-87 (12-103), 0.64
Difference from Uniprot sequence cloning artifact:engineered mutation
Mutations (UniProt numbering) R31H, A34S, E36S, I41L, I48L, L63R, L87S
Insertions None
Deletions A2-R11, D104-S146
Sequence identity to UniProt 0.9247
auth_asym_id D
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00001b5m , Chain A 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 3-86 (19-102), 0.58
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P18, K103-S146
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB