Danish
Uniprot ID:  P05979
  • Protein: Prostaglandin G/H synthase 1
  • Organism: Sheep (Ovis aries)
  • Length: 600
  • Sequence:
    • MSRQSISLRFPLLLLLLSPSPVFSADPGAPAPVNPCCYYPCQHQGICVRFGLDRYQCDCTRTGYSGPNCTIPEIWTWLRTTLRPSPSFIHFLLTHGRWLWDFVNATFIRDTLMRLVLTVRSNLIPSPPTYNIAHDYISWESFSNVSYYTRILPSVPRDCPTPMDTKGKKQLPDAEFLSRRFLLRRKFIPDPQSTNLMFAFFAQHFTHQFFKTSGKMGPGFTKALGHGVDLGHIYGDNLERQYQLRLFKDGKLKYQMLNGEVYPPSVEEAPVLMHYPRGIPPQSQMAVGQEVFGLLPGLMLYATIWLREHNRVCDLLKAEHPTWGDEQLFQTARLILIGETIKIVIEEYVQQLSGYFLQLKFDPELLFGAQFQYRNRIAMEFNQLYHWHPLMPDSFRVGPQDYSYEQFLFNTSMLVDYGVEALVDAFSRQPAGRIGGGRNIDHHILHVAVDVIKESRVLRLQPFNEYRKRFGMKPYTSFQELTGEKEMAAELEELYGDIDALEFYPGLLLEKCHPNSIFGESMIEMGAPFSLKGLLGNPICSPEYWKASTFGGEVGFNLVKTATLKKLVCLNTKTCPYVSFHVPDPRQEDRPGVERPPTEL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  47
PDB ID:  pdb_00001q4g , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id A
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00001q4g , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id B
label_asym_ids of heme V
Available structure PDB
PDB ID:  pdb_00004o1z , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 32-584 (32-600), 0.95
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31
Sequence identity to UniProt 0.9965
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00004o1z , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 32-584 (32-600), 0.95
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31
Sequence identity to UniProt 0.9965
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00003n8y , Chain A 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00003n8y , Chain B 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence conflict:microheterogeneity
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id B
Missing residues 530SER-530SER
Nonstandard amino acids OAS Structure of OASOAS
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00001eqg , Chain A 
Resolution 2.61 Å
Residue indices (Uniprot), coverage 33-583 (21-600), 0.97
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S20
Sequence identity to UniProt 0.9966
auth_asym_id A
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00001eqg , Chain B 
Resolution 2.61 Å
Residue indices (Uniprot), coverage 33-583 (21-600), 0.97
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S20
Sequence identity to UniProt 0.9966
auth_asym_id B
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00001ht8 , Chain A 
Resolution 2.69 Å
Residue indices (Uniprot), coverage 33-583 (33-583), 0.92
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-P32, D584-L600
Sequence identity to UniProt 0.9964
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00001ht8 , Chain B 
Resolution 2.69 Å
Residue indices (Uniprot), coverage 33-583 (33-583), 0.92
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-P32, D584-L600
Sequence identity to UniProt 0.9964
auth_asym_id B
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00001eqh , Chain A 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 33-583 (21-600), 0.97
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S20
Sequence identity to UniProt 0.9966
auth_asym_id A
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00001eqh , Chain B 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 33-583 (21-600), 0.97
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S20
Sequence identity to UniProt 0.9966
auth_asym_id B
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00002oyu , Chain A 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 32-584 (1-600), 1.00
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id P
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00002oyu , Chain A-1 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 32-584 (1-600), 1.00
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id P
label_asym_ids of heme H-1
Available structure PDB
PDB ID:  pdb_00001ht5 , Chain A 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 33-583 (33-583), 0.92
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-P32, D584-L600
Sequence identity to UniProt 0.9964
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00001ht5 , Chain B 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 33-583 (33-583), 0.92
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-P32, D584-L600
Sequence identity to UniProt 0.9964
auth_asym_id B
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00003kk6 , Chain A 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00003kk6 , Chain B 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id B
Structural gaps Exists
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00003n8w , Chain A 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003n8w , Chain B 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) R120Q, D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9946
auth_asym_id B
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00003n8x , Chain A 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003n8x , Chain B 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00005wbe , Chain A 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 32-584 (1-600), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00005wbe , Chain B 
Resolution 2.75 Å
Residue indices (Uniprot), coverage 32-584 (1-600), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00002oye , Chain A 
Resolution 2.85 Å
Residue indices (Uniprot), coverage 32-584 (1-600), 1.00
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id P
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00002oye , Chain A-1 
Resolution 2.85 Å
Residue indices (Uniprot), coverage 32-584 (1-600), 1.00
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions None
Sequence identity to UniProt 0.9967
auth_asym_id P
label_asym_ids of heme H-1
Available structure PDB
PDB ID:  pdb_00003n8z , Chain A 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00003n8z , Chain B 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id B
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00005u6x , Chain A 
Resolution 2.93 Å
Residue indices (Uniprot), coverage 32-584 (1-600), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00005u6x , Chain B 
Resolution 2.93 Å
Residue indices (Uniprot), coverage 32-584 (1-600), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00003n8v , Chain A 
Resolution 3.05 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003n8v , Chain B 
Resolution 3.05 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 0.9964
auth_asym_id B
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00001cqe , Chain A 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 32-583 (21-600), 0.97
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S20
Sequence identity to UniProt 0.9966
auth_asym_id A
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00001cqe , Chain B 
Resolution 3.10 Å
Residue indices (Uniprot), coverage 31-583 (21-600), 0.97
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S20
Sequence identity to UniProt 0.9966
auth_asym_id B
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00001ebv , Chain A 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 33-583 (33-583), 0.92
Difference from Uniprot sequence conflict:modified residue
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-P32, D584-L600
Sequence identity to UniProt 0.9964
auth_asym_id A
Missing residues 530SER-530SER
Nonstandard amino acids OAS Structure of OASOAS
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00007jxt , Chain A 
Resolution 3.35 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00007jxt , Chain B 
Resolution 3.35 Å
Residue indices (Uniprot), coverage 32-584 (32-584), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A31, P585-L600
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00001pth , Chain A 
Resolution 3.40 Å
Residue indices (Uniprot), coverage 33-583 (25-600), 0.96
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S24
Sequence identity to UniProt 0.9965
auth_asym_id A
Missing residues 530SER-530SER
Nonstandard amino acids 0AH Structure of 0AH0AH
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00001pth , Chain B 
Resolution 3.40 Å
Residue indices (Uniprot), coverage 33-583 (25-600), 0.96
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S24
Sequence identity to UniProt 0.9965
auth_asym_id B
Missing residues 530SER-530SER
Nonstandard amino acids 0AH Structure of 0AH0AH
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00001pge , Chain A 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 33-583 (25-600), 0.96
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S24
Sequence identity to UniProt 0.9965
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001pge , Chain B 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 33-583 (25-600), 0.96
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S24
Sequence identity to UniProt 0.9965
auth_asym_id B
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00001prh , Chain A 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 33-586 (33-586), 0.92
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D164G, S193G, N310Q, R333K
Insertions None
Deletions M1-P32, Q587-L600
Sequence identity to UniProt 0.9928
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001prh , Chain B 
Resolution 3.50 Å
Residue indices (Uniprot), coverage 33-586 (33-586), 0.92
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) D164G, S193G, N310Q, R333K
Insertions None
Deletions M1-P32, Q587-L600
Sequence identity to UniProt 0.9928
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001pgf , Chain A 
Resolution 4.50 Å
Residue indices (Uniprot), coverage 33-583 (25-600), 0.96
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S24
Sequence identity to UniProt 0.9965
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001pgf , Chain B 
Resolution 4.50 Å
Residue indices (Uniprot), coverage 33-583 (25-600), 0.96
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S24
Sequence identity to UniProt 0.9965
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00001pgg , Chain A 
Resolution 4.50 Å
Residue indices (Uniprot), coverage 33-583 (25-600), 0.96
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S24
Sequence identity to UniProt 0.9965
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001pgg , Chain B 
Resolution 4.50 Å
Residue indices (Uniprot), coverage 33-583 (25-600), 0.96
Mutations (UniProt numbering) D164G, S193G
Insertions None
Deletions M1-S24
Sequence identity to UniProt 0.9965
auth_asym_id B
label_asym_ids of heme K
Available structure PDB