Danish
Uniprot ID:  P06148
  • Protein: Hemoglobin F-I
  • Organism: Innkeeper worm (Urechis caupo)
  • Length: 142
  • Sequence:
    • MGLTTAQIKAIQDHWFLNIKGCLQAAADSIFFKYLTAYPGDLAFFHKFSSVPLYGLRSNPAYKAQTLTVINYLDKVVDALGGNAGALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSADPTTVAAWGDAAGVLVAAMK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001ith , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) T5A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9929
auth_asym_id A
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001ith , Chain A-1 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) T5A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9929
auth_asym_id A
label_asym_ids of heme D-1
Available structure PDB
PDB ID:  pdb_00001ith , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) T5A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9929
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001ith , Chain B-1 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-141 (2-142), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) T5A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9929
auth_asym_id B
label_asym_ids of heme F-1
Available structure PDB