Danish

Uniprot ID: P06148

Protein: Hemoglobin F-I
Organism: Innkeeper worm (Urechis caupo)
Length: 142
Sequence:

MGLTTAQIKAIQDHWFLNIKGCLQAAADSIFFKYLTAYPGDLAFFHKFSSVPLYGLRSNPAYKAQTLTVINYLDKVVDALGGNAGALMKAKVPSHDAMGITPKHFGQLLKLVGGVFQEEFSADPTTVAAWGDAAGVLVAAMK

Number of chains: 4

PDB ID: 1ith , Chain A
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 1ith , Chain A-1
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	A
label_asym_ids of heme	D-1
Available structure	PDB

PDB ID: 1ith , Chain B
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	B
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 1ith , Chain B-1
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-141 (2-142), 0.99
Difference from Uniprot sequence	conflict
auth_asym_id	B
label_asym_ids of heme	F-1
Available structure	PDB