Danish

Uniprot ID: P09190

Protein: Cytochrome b559 subunit alpha
Organism:
Length: 81
Sequence:

MSGTTGERPFSDIVTSIRYWVIHSITIPMLFIAGWLFVSTGLAYDAFGTPRPDEYFTQTRQELPILQERYDINQEIQEFNQ

Number of chains: 9

PDB ID: 6wj6 , Chain E
Residue indices (Uniprot), coverage	9-80 (1-81), 1.00
auth_asym_id	E
label_asym_ids of heme	YB
Available structure	PDB

PDB ID: 7n8o , Chain E
Residue indices (Uniprot), coverage	3-80 (1-81), 1.00
auth_asym_id	E
label_asym_ids of heme	XD
Available structure	PDB

PDB ID: 7n8o , Chain Z
Residue indices (Uniprot), coverage	3-80 (1-81), 1.00
auth_asym_id	e
label_asym_ids of heme	II
Available structure	PDB

PDB ID: 7rcv , Chain E
Residue indices (Uniprot), coverage	3-80 (1-81), 1.00
auth_asym_id	E
label_asym_ids of heme	XD
Available structure	PDB

PDB ID: 7rcv , Chain Z
Residue indices (Uniprot), coverage	3-80 (1-81), 1.00
auth_asym_id	e
label_asym_ids of heme	HI
Available structure	PDB

PDB ID: 8am5 , Chain C
Residue indices (Uniprot), coverage	20-56 (1-81), 1.00
auth_asym_id	E
label_asym_ids of heme	BA
Available structure	PDB

PDB ID: 8asl , Chain N
Residue indices (Uniprot), coverage	13-56 (1-81), 1.00
auth_asym_id	E
label_asym_ids of heme	FF
Available structure	PDB

PDB ID: 8tow , Chain E
Residue indices (Uniprot), coverage	3-80 (1-81), 1.00
auth_asym_id	E
label_asym_ids of heme	VD
Available structure	PDB

PDB ID: 8tow , Chain Z
Residue indices (Uniprot), coverage	3-80 (1-81), 1.00
auth_asym_id	e
label_asym_ids of heme	HI
Available structure	PDB