- Protein: Cytochrome b559 subunit beta
- Organism:
- Length: 44
- Sequence:
MATQNPNQPVTYPIFTVRWLAVHTLAVPSVFFVGAIAAMQFIQR
| Residue indices (Uniprot), coverage | 13-44 (1-44), 1.00 |
|---|---|
| auth_asym_id | F |
| label_asym_ids of heme | YB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 10-44 (1-44), 1.00 |
|---|---|
| auth_asym_id | f |
| label_asym_ids of heme | II |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 10-44 (1-44), 1.00 |
|---|---|
| auth_asym_id | F |
| label_asym_ids of heme | XD |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 10-44 (1-44), 1.00 |
|---|---|
| auth_asym_id | f |
| label_asym_ids of heme | HI |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 10-44 (1-44), 1.00 |
|---|---|
| auth_asym_id | F |
| label_asym_ids of heme | XD |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 17-44 (1-44), 1.00 |
|---|---|
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | F |
| label_asym_ids of heme | BA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 17-44 (1-44), 1.00 |
|---|---|
| auth_asym_id | F |
| label_asym_ids of heme | FF |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 10-44 (1-44), 1.00 |
|---|---|
| auth_asym_id | f |
| label_asym_ids of heme | HI |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 10-44 (1-44), 1.00 |
|---|---|
| auth_asym_id | F |
| label_asym_ids of heme | VD |
| Available structure | PDB |