Danish

Uniprot ID: P0AC44

Protein: Succinate dehydrogenase hydrophobic membrane anchor subunit
Organism:
Length: 115
Sequence:

MVSNASALGRNGVHDFILVRATAIVLTLYIIYMVGFFATSGELTYEVWIGFFASAFTKVFTLLALFSILIHAWIGMWQVLTDYVKPLALRLMLQLVIVVALVVYVIYGFVVVWGV

Number of chains: 26

PDB ID: 2wdq , Chain D
Resolution	2.40 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	D
label_asym_ids of heme	T
Available structure	PDB

PDB ID: 2wdq , Chain L
Resolution	2.40 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	L
label_asym_ids of heme	LA
Available structure	PDB

PDB ID: 2wdq , Chain H
Resolution	2.40 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	H
label_asym_ids of heme	CA
Available structure	PDB

PDB ID: 2wu2 , Chain D
Resolution	2.50 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	D
label_asym_ids of heme	S
Available structure	PDB

PDB ID: 2wu2 , Chain H
Resolution	2.50 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	H
label_asym_ids of heme	AA
Available structure	PDB

PDB ID: 2wu2 , Chain L
Resolution	2.50 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	L
label_asym_ids of heme	IA
Available structure	PDB

PDB ID: 1nek , Chain D
Resolution	2.60 Å
Residue indices (Uniprot), coverage	3-115 (1-115), 1.00
auth_asym_id	D
label_asym_ids of heme	L
Available structure	PDB

PDB ID: 2wp9 , Chain D
Resolution	2.70 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	D
label_asym_ids of heme	S
Available structure	PDB

PDB ID: 2wp9 , Chain H
Resolution	2.70 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	H
label_asym_ids of heme	AA
Available structure	PDB

PDB ID: 2wp9 , Chain L
Resolution	2.70 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	L
label_asym_ids of heme	IA
Available structure	PDB

PDB ID: 2wu5 , Chain H
Resolution	2.80 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	H
label_asym_ids of heme	AA
Available structure	PDB

PDB ID: 2wu5 , Chain D
Resolution	2.80 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	D
label_asym_ids of heme	S
Available structure	PDB

PDB ID: 2wu5 , Chain L
Resolution	2.80 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	L
label_asym_ids of heme	IA
Available structure	PDB

PDB ID: 1nen , Chain D
Resolution	2.90 Å
Residue indices (Uniprot), coverage	3-115 (1-115), 1.00
auth_asym_id	D
label_asym_ids of heme	L
Available structure	PDB

PDB ID: 2acz , Chain D
Resolution	3.10 Å
Residue indices (Uniprot), coverage	3-115 (1-115), 1.00
auth_asym_id	D
label_asym_ids of heme	J
Available structure	PDB

PDB ID: 2acz , Chain D-1
Resolution	3.10 Å
Residue indices (Uniprot), coverage	3-115 (1-115), 1.00
auth_asym_id	D
label_asym_ids of heme	J-1
Available structure	PDB

PDB ID: 2acz , Chain D-2
Resolution	3.10 Å
Residue indices (Uniprot), coverage	3-115 (1-115), 1.00
auth_asym_id	D
label_asym_ids of heme	J-2
Available structure	PDB

PDB ID: 2wdr , Chain D
Resolution	3.20 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	D
label_asym_ids of heme	S
Available structure	PDB

PDB ID: 2wdr , Chain H
Resolution	3.20 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	H
label_asym_ids of heme	AA
Available structure	PDB

PDB ID: 2wdr , Chain L
Resolution	3.20 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	L
label_asym_ids of heme	IA
Available structure	PDB

PDB ID: 2wdv , Chain D
Resolution	3.20 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	D
label_asym_ids of heme	S
Available structure	PDB

PDB ID: 2wdv , Chain H
Resolution	3.20 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	H
label_asym_ids of heme	Z
Available structure	PDB

PDB ID: 2wdv , Chain L
Resolution	3.20 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
auth_asym_id	L
label_asym_ids of heme	GA
Available structure	PDB

PDB ID: 2ws3 , Chain L
Resolution	3.20 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	L
label_asym_ids of heme	JA
Available structure	PDB

PDB ID: 2ws3 , Chain H
Resolution	3.20 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	H
label_asym_ids of heme	BA
Available structure	PDB

PDB ID: 2ws3 , Chain D
Resolution	3.20 Å
Residue indices (Uniprot), coverage	11-115 (1-115), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	D
label_asym_ids of heme	T
Available structure	PDB