- Protein: Cytochrome c2
- Organism: Rhodobacter sphaeroides (Cereibacter sphaeroides)
- Length: 124
- Sequence:
QEGDPEAGAKAFNQCQTCHVIVDDSGTTIAGRNAKTGPNLYGVVGRTAGTQADFKGYGEGMKEAGAKGLAWDEEHFVQYVQDPTKFLKEYTGDAKAKGKMTFKLKKEADAHNIWAYLQQVAVRP
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-124 (1-124), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-124 (1-124), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-124 (1-124), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-124 (1-124), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-124 (1-124), 1.00 |
| auth_asym_id | C |
| label_asym_ids of heme | Y |
| Available structure | PDB |
| Resolution | 3.25 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-124 (1-124), 1.00 |
| auth_asym_id | C |
| label_asym_ids of heme | T |
| Available structure | PDB |
| Resolution | 3.25 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-124 (1-124), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | FA |
| Available structure | PDB |