Danish
Uniprot ID:  P0C278
  • Protein: Fumarate reductase (cytochrome)
  • Organism: Shewanella frigidimarina
  • Length: 571
  • Sequence:
    • ADNLAEFHVQNQECDSCHTPDGELSNDSLTYENTQCVSCHGTLEEVAETTKHEHYNAHASHFPGEVACTSCHSAHEKSMVYCDSCHSFDFNMPYAKKWQRDEPTIAELAKDKSERQAALASAPHDTVDVVVVGSGGAGFSAAISATDSGAKVILIEKEPVIGGNAKLAAGGMNAAWTDQQKAKKITDSPELMFEDTMKGGQNINDPALVKVLSSHSKDSVDWMTAMGADLTDVGMMGGASVNRAHRPTGGAGVGAHVVQVLYDNAVKRNIDLRMNTRGIEVLKDDKGTVKGILVKGMYKGYYWVKADAVILATGGFAKNNERVAKLDPSLKGFISTNQPGAVGDGLDVAENAGGALKDMQYIQAHPTLSVKGGVMVTEAVRGNGAILVNREGKRFVNEITTRDKASAAILAQTGKSAYLIFDDSVRKSLSKIDKYIGLGVAPTADSLVKLGKMEGIDGKALTETVARYNSLVSSGKDTDFERPNLPRALNEGNYYAIEVTPGVHHTMGGVMIDTKAEVMNAKKQVIPGLYGAGEVTGGVHGANRLGGNAISDIITFGRLAGEEAAKYSKKN
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  19
PDB ID:  pdb_00001y0p , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Mutations (UniProt numbering) E44A, Q99L
Insertions None
Deletions None
Sequence identity to UniProt 0.9965
auth_asym_id A
label_asym_ids of heme C ,  D ,  E ,  F
Available structure PDB
PDB ID:  pdb_00002b7r , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, E378D
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id A
label_asym_ids of heme C ,  D ,  E ,  F
Available structure PDB
PDB ID:  pdb_00001e39 , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, H365A
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id A
label_asym_ids of heme B ,  C ,  D ,  E
Available structure PDB
PDB ID:  pdb_00001kss , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, H505A
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id A
label_asym_ids of heme C ,  D ,  E ,  F
Available structure PDB
PDB ID:  pdb_00001m64 , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, Q363F
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id A
label_asym_ids of heme D ,  E ,  F ,  G
Available structure PDB
PDB ID:  pdb_00001m64 , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, Q363F
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id B
label_asym_ids of heme K ,  L ,  M ,  N
Available structure PDB
PDB ID:  pdb_00001jrx , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, R402A
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id A
label_asym_ids of heme D ,  E ,  F ,  G
Available structure PDB
PDB ID:  pdb_00001jrx , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, R402A
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id B
label_asym_ids of heme K ,  L ,  M ,  N
Available structure PDB
PDB ID:  pdb_00001jry , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, R402K
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id A
label_asym_ids of heme D ,  E ,  F ,  G
Available structure PDB
PDB ID:  pdb_00001jry , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, R402K
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id B
label_asym_ids of heme K ,  L ,  M ,  N
Available structure PDB
PDB ID:  pdb_00001jrz , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, R402Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id A
label_asym_ids of heme D ,  E ,  F ,  G
Available structure PDB
PDB ID:  pdb_00001jrz , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, R402Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id B
label_asym_ids of heme K ,  L ,  M ,  N
Available structure PDB
PDB ID:  pdb_00001ksu , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, H505Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id A
label_asym_ids of heme D ,  E ,  F ,  G
Available structure PDB
PDB ID:  pdb_00001ksu , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, H505Y
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id B
label_asym_ids of heme K ,  L ,  M ,  N
Available structure PDB
PDB ID:  pdb_00001lj1 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, Q363F, R402A
Insertions None
Deletions None
Sequence identity to UniProt 0.9930
auth_asym_id A
label_asym_ids of heme D ,  E ,  F ,  G
Available structure PDB
PDB ID:  pdb_00001lj1 , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, Q363F, R402A
Insertions None
Deletions None
Sequence identity to UniProt 0.9930
auth_asym_id B
label_asym_ids of heme K ,  L ,  M ,  N
Available structure PDB
PDB ID:  pdb_00001p2h , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, H61M, Q99L
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id A
label_asym_ids of heme F ,  E ,  D ,  C
Available structure PDB
PDB ID:  pdb_00002b7s , Chain A 
Resolution 2.12 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, Q99L, R381K
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id A
label_asym_ids of heme C ,  D ,  E ,  F
Available structure PDB
PDB ID:  pdb_00001p2e , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-568 (1-571), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) E44A, H61A, Q99L
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id A
label_asym_ids of heme C ,  D ,  E ,  F
Available structure PDB