- Protein: Cytochrome b
- Organism: Yeast (Candida albicans (strain SC5314 / ATCC MYA-2876))
- Length: 387
- Sequence:
MPTRKSNTYLSLVNSYLIDSPQPSSINYWWNLGSLLGLCLVIQIASGVFLAMHYSSNIELAFDSVEHIMRDVNAGWLIRYIHANGASFFFICMYLHIGKALYYGSYKQPRVMLWVIGVVIFILTMAIAFMGYCLVYGQMSHWGATVITNLLSAIPFIGNDIVPFIWGGFSVSNPTIQRFFALHFLLPFILAALVCMHLMALHVHGSSNPVGITGNIDRLPMHPYFIFKDLITVFVFLLIFSLFVFYSPNTLGHPDNYIPGNPMVTPPSIVPEWYLLPFYAILRSIPDKLGGVIAMFGAILILLSLPYTDRSIIRGNSFKVLSKLAFYLFVFNFILLGNLGQLHVEVPYIQLGQFATAYYFAHYIIVVPVISTLENILYYIGTQTRVK
| Residue indices (Uniprot), coverage | 1-383 (1-387), 1.00 |
|---|---|
| auth_asym_id | K |
| label_asym_ids of heme | S , T |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-383 (1-387), 1.00 |
|---|---|
| auth_asym_id | T |
| label_asym_ids of heme | Y , Z |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-383 (1-387), 1.00 |
|---|---|
| auth_asym_id | K |
| label_asym_ids of heme | K , L |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-383 (1-387), 1.00 |
|---|---|
| auth_asym_id | K |
| label_asym_ids of heme | K , L |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-383 (1-387), 1.00 |
|---|---|
| auth_asym_id | K |
| label_asym_ids of heme | L , M |
| Available structure | PDB |