Danish
Uniprot ID:  P10614
  • Protein: Lanosterol 14-alpha demethylase CYP51
  • Organism: Baker's yeast (Saccharomyces cerevisiae (strain ATCC 204508 / S288c))
  • Length: 530
  • Sequence:
    • MSATKSIVGEALEYVNIGLSHFLALPLAQRISLIIIIPFIYNIVWQLLYSLRKDRPPLVFYWIPWVGSAVVYGMKPYEFFEECQKKYGDIFSFVLLGRVMTVYLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALTKEAFKSYVPLIAEEVYKYFRDSKNFRLNERTTGTIDVMVTQPEMTIFTASRSLLGKEMRAKLDTDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNNDIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHYPEGKTVPPPDFTSMVTLPTGPAKIIWEKRNPEQKI
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  9
PDB ID:  pdb_00008vk6 , Chain A 
Resolution 1.89 Å
Residue indices (Uniprot), coverage 6-532 (1-530), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) K433N
Insertions 530insGGRHHHHHH
Deletions None
Sequence identity to UniProt 0.9981
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00004lxj , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 6-535 (1-530), 1.00
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) K433N
Insertions 530insGGRHHH
Deletions None
Sequence identity to UniProt 0.9981
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00008dl4 , Chain A 
Resolution 1.91 Å
Residue indices (Uniprot), coverage 8-532 (1-530), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) K433N
Insertions 530insGGRHHHHHH
Deletions None
Sequence identity to UniProt 0.9981
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007ry8 , Chain A 
Resolution 1.98 Å
Residue indices (Uniprot), coverage 7-533 (1-530), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Y140H, K433N
Insertions 530insGGRHHHHHH
Deletions None
Sequence identity to UniProt 0.9962
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007rya , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 7-535 (1-530), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) K433N, I471T
Insertions 530insGGRHHHHHH
Deletions None
Sequence identity to UniProt 0.9962
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007ryx , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 7-534 (1-530), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) K433N
Insertions 530insGGRHHH
Deletions None
Sequence identity to UniProt 0.9981
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00005eqb , Chain A 
Resolution 2.19 Å
Residue indices (Uniprot), coverage 6-536 (1-530), 1.00
Difference from Uniprot sequence conflict:expression tag
Mutations (UniProt numbering) K433N
Insertions 530insGGRHHHHHH
Deletions None
Sequence identity to UniProt 0.9981
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007ry9 , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 8-534 (1-530), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) K433N, I471T
Insertions 530insGGRHHHHHH
Deletions None
Sequence identity to UniProt 0.9962
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00007ryb , Chain A 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 9-531 (1-530), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) Y140H, K433N, I471T
Insertions 530insGGRHHHHHH
Deletions None
Sequence identity to UniProt 0.9943
auth_asym_id A
label_asym_ids of heme B
Available structure PDB