- Protein: Lanosterol 14-alpha demethylase CYP51
- Organism: Baker's yeast (Saccharomyces cerevisiae (strain ATCC 204508 / S288c))
- Length: 530
- Sequence:
MSATKSIVGEALEYVNIGLSHFLALPLAQRISLIIIIPFIYNIVWQLLYSLRKDRPPLVFYWIPWVGSAVVYGMKPYEFFEECQKKYGDIFSFVLLGRVMTVYLGPKGHEFVFNAKLADVSAEAAYAHLTTPVFGKGVIYDCPNSRLMEQKKFVKGALTKEAFKSYVPLIAEEVYKYFRDSKNFRLNERTTGTIDVMVTQPEMTIFTASRSLLGKEMRAKLDTDFAYLYSDLDKGFTPINFVFPNLPLEHYRKRDHAQKAISGTYMSLIKERRKNNDIQDRDLIDSLMKNSTYKDGVKMTDQEIANLLIGVLMGGQHTSAATSAWILLHLAERPDVQQELYEEQMRVLDGGKKELTYDLLQEMPLLNQTIKETLRMHHPLHSLFRKVMKDMHVPNTSYVIPAGYHVLVSPGYTHLRDEYFPNAHQFNIHRWNKDSASSYSVGEEVDYGFGAISKGVSSPYLPFGGGRHRCIGEHFAYCQLGVLMSIFIRTLKWHYPEGKTVPPPDFTSMVTLPTGPAKIIWEKRNPEQKI
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 6-535 (1-530), 1.00 |
| Difference from Uniprot sequence | conflict:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.91 Å |
|---|---|
| Residue indices (Uniprot), coverage | 8-532 (1-530), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.98 Å |
|---|---|
| Residue indices (Uniprot), coverage | 7-533 (1-530), 1.00 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 7-535 (1-530), 1.00 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 7-534 (1-530), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 2.19 Å |
|---|---|
| Residue indices (Uniprot), coverage | 6-536 (1-530), 1.00 |
| Difference from Uniprot sequence | conflict:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 2.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 8-534 (1-530), 1.00 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 2.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 9-531 (1-530), 1.00 |
| Difference from Uniprot sequence | engineered mutation:expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |