Danish

Uniprot ID: P13554

Protein: Cytochrome b559 subunit alpha
Organism: Garden pea (Pisum sativum)
Length: 83
Sequence:

MSGSTGERSFADIITSIRYWIIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTETRQGIPLITGRFDSLEQLDEFSRSF

Number of chains: 6

PDB ID: 5xnl , Chain I
Residue indices (Uniprot), coverage	8-82 (1-83), 1.00
auth_asym_id	E
label_asym_ids of heme	VG
Available structure	PDB

PDB ID: 5xnl , Chain KA
Residue indices (Uniprot), coverage	8-82 (1-83), 1.00
auth_asym_id	e
label_asym_ids of heme	GQ
Available structure	PDB

PDB ID: 5xnm , Chain I
Residue indices (Uniprot), coverage	8-82 (1-83), 1.00
auth_asym_id	E
label_asym_ids of heme	RG
Available structure	PDB

PDB ID: 5xnm , Chain JA
Residue indices (Uniprot), coverage	8-82 (1-83), 1.00
auth_asym_id	e
label_asym_ids of heme	AQ
Available structure	PDB

PDB ID: 6yp7 , Chain BA
Residue indices (Uniprot), coverage	8-82 (8-82), 0.90
auth_asym_id	E
label_asym_ids of heme	None
Available structure	PDB

PDB ID: 6yp7 , Chain K
Residue indices (Uniprot), coverage	8-82 (8-82), 0.90
auth_asym_id	e
label_asym_ids of heme	None
Available structure	PDB