- Protein: Cytochrome P450 11B1, mitochondrial
- Organism: Human (Homo sapiens)
- Length: 503
- Sequence:
MALRAKAEVCMAVPWLSLQRAQALGTRAARVPRTVLPFEAMPRRPGNRWLRLLQIWREQGYEDLHLEVHQTFQELGPIFRYDLGGAGMVCVMLPEDVEKLQQVDSLHPHRMSLEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPEVLSPNAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWTSPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFSRPQQYTSIVAELLLNAELSPDAIKANSMELTAGSVDTTVFPLLMTLFELARNPNVQQALRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVASSDLVLQNYHIPAGTLVRVFLYSLGRNPALFPRPERYNPQRWLDIRGSGRNFYHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHLQVETLTQEDIKMVYSFILRPSMFPLLTFRAIN
| Resolution | 1.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 31-502 (28-503), 0.95 |
| Difference from Uniprot sequence | engineered mutation:expression tag:initiating methionine |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 34-502 (31-503), 0.94 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| Structural gaps | Exists |
| label_asym_ids of heme | D |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.10 Å |
| Resolution | 2.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 34-502 (31-503), 0.94 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| Structural gaps | Exists |
| label_asym_ids of heme | F |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |