Danish

Uniprot ID: P17413

Protein: Fumarate reductase cytochrome b subunit
Organism: Vibrio succinogenes (Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / CCUG 13145 / JCM 31913 / LMG 7466 / NCTC 11488 / FDC 602W))
Length: 256
Sequence:

MTNESILESYSGVTPERKKSRMPAKLDWWQSATGLFLGLFMIGHMFFVSTILLGDNVMLWVTKKFELDFIFEGGKPIVVSFLAAFVFAVFIAHAFLAMRKFPINYRQYLTFKTHKDLMRHGDTTLWWIQAMTGFAMFFLGSVHLYIMMTQPQTIGPVSSSFRMVSEWMWPLYLVLLFAVELHGSVGLYRLAVKWGWFDGETPDKTRANLKKLKTLMSAFLIVLGLLTFGAYVKKGLEQTDPNIDYKYFDYKRTHHR

Number of chains: 12

PDB ID: 2bs2 , Chain C
Resolution	1.78 Å
Residue indices (Uniprot), coverage	1-254 (1-254), 0.99
auth_asym_id	C
label_asym_ids of heme	M , N
Available structure	PDB

PDB ID: 2bs2 , Chain F
Resolution	1.78 Å
Residue indices (Uniprot), coverage	1-254 (1-254), 0.99
auth_asym_id	F
label_asym_ids of heme	V , W
Available structure	PDB

PDB ID: 2bs3 , Chain C
Resolution	2.19 Å
Residue indices (Uniprot), coverage	1-254 (1-256), 1.00
Difference from Uniprot sequence	conflict
auth_asym_id	C
label_asym_ids of heme	M , N
Available structure	PDB

PDB ID: 2bs3 , Chain F
Resolution	2.19 Å
Residue indices (Uniprot), coverage	1-254 (1-256), 1.00
Difference from Uniprot sequence	conflict
auth_asym_id	F
label_asym_ids of heme	V , W
Available structure	PDB

PDB ID: 1qlb , Chain C
Resolution	2.33 Å
Residue indices (Uniprot), coverage	1-254 (1-256), 1.00
auth_asym_id	C
label_asym_ids of heme	M , N
Available structure	PDB

PDB ID: 1qlb , Chain F
Resolution	2.33 Å
Residue indices (Uniprot), coverage	1-254 (1-256), 1.00
auth_asym_id	F
label_asym_ids of heme	V , W
Available structure	PDB

PDB ID: 2bs4 , Chain C
Resolution	2.76 Å
Residue indices (Uniprot), coverage	1-254 (1-256), 1.00
Difference from Uniprot sequence	conflict
auth_asym_id	C
label_asym_ids of heme	J , K
Available structure	PDB

PDB ID: 2bs4 , Chain F
Resolution	2.76 Å
Residue indices (Uniprot), coverage	1-254 (1-256), 1.00
Difference from Uniprot sequence	conflict
auth_asym_id	F
label_asym_ids of heme	W , X
Available structure	PDB

PDB ID: 1e7p , Chain C
Resolution	3.10 Å
Residue indices (Uniprot), coverage	1-254 (1-256), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	C
label_asym_ids of heme	S , T
Available structure	PDB

PDB ID: 1e7p , Chain F
Resolution	3.10 Å
Residue indices (Uniprot), coverage	1-254 (1-256), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	F
label_asym_ids of heme	CA , DA
Available structure	PDB

PDB ID: 1e7p , Chain I
Resolution	3.10 Å
Residue indices (Uniprot), coverage	1-254 (1-256), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	I
label_asym_ids of heme	KA , LA
Available structure	PDB

PDB ID: 1e7p , Chain L
Resolution	3.10 Å
Residue indices (Uniprot), coverage	1-254 (1-256), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	L
label_asym_ids of heme	UA , VA
Available structure	PDB