Danish

Uniprot ID: P19099

Protein: Cytochrome P450 11B2, mitochondrial
Organism: Human (Homo sapiens)
Length: 503
Sequence:

MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN

Number of chains: 54

PDB ID: 4dvq , Chain A
Resolution	2.49 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	M
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 4dvq , Chain B
Resolution	2.49 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	P
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4dvq , Chain C
Resolution	2.49 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	S
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4dvq , Chain D
Resolution	2.49 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	V
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4dvq , Chain E
Resolution	2.49 Å
Residue indices (Uniprot), coverage	34-509 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	E
Structural gaps	Exists
label_asym_ids of heme	Y
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4dvq , Chain F
Resolution	2.49 Å
Residue indices (Uniprot), coverage	34-509 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	F
Structural gaps	Exists
label_asym_ids of heme	BA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 4dvq , Chain G
Resolution	2.49 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	G
Structural gaps	Exists
label_asym_ids of heme	EA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4dvq , Chain H
Resolution	2.49 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	H
Structural gaps	Exists
label_asym_ids of heme	HA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 4dvq , Chain I
Resolution	2.49 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	I
Structural gaps	Exists
label_asym_ids of heme	JA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4dvq , Chain J
Resolution	2.49 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	J
Structural gaps	Exists
label_asym_ids of heme	LA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 4dvq , Chain K
Resolution	2.49 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	K
Structural gaps	Exists
label_asym_ids of heme	NA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4dvq , Chain L
Resolution	2.49 Å
Residue indices (Uniprot), coverage	36-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	L
Structural gaps	Exists
label_asym_ids of heme	QA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4fdh , Chain A
Resolution	2.71 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	M
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 4fdh , Chain B
Resolution	2.71 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	O
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.14 Å

PDB ID: 4fdh , Chain C
Resolution	2.71 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	Q
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 4fdh , Chain D
Resolution	2.71 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	S
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 4fdh , Chain E
Resolution	2.71 Å
Residue indices (Uniprot), coverage	34-509 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	E
Structural gaps	Exists
label_asym_ids of heme	U
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 4fdh , Chain F
Resolution	2.71 Å
Residue indices (Uniprot), coverage	34-509 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	F
Structural gaps	Exists
label_asym_ids of heme	W
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 4fdh , Chain G
Resolution	2.71 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	G
Structural gaps	Exists
label_asym_ids of heme	Y
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 4fdh , Chain H
Resolution	2.71 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	H
Structural gaps	Exists
label_asym_ids of heme	AA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 4fdh , Chain I
Resolution	2.71 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	I
Structural gaps	Exists
label_asym_ids of heme	CA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 4fdh , Chain J
Resolution	2.71 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	J
Structural gaps	Exists
label_asym_ids of heme	EA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 4fdh , Chain K
Resolution	2.71 Å
Residue indices (Uniprot), coverage	34-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	K
label_asym_ids of heme	GA
Available structure	PDB

PDB ID: 4fdh , Chain L
Resolution	2.71 Å
Residue indices (Uniprot), coverage	36-502 (34-503), 0.93
Difference from Uniprot sequence	expression tag
auth_asym_id	L
Structural gaps	Exists
label_asym_ids of heme	IA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 6xz9 , Chain A
Resolution	2.77 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	D
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 6xz9 , Chain B
Resolution	2.77 Å
Residue indices (Uniprot), coverage	32-504 (28-503), 0.95
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	B
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 6xz9 , Chain C
Resolution	2.77 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	H
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 6xz8 , Chain A
Resolution	3.00 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	D
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 6xz8 , Chain B
Resolution	3.00 Å
Residue indices (Uniprot), coverage	32-504 (28-503), 0.95
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	B
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 6xz8 , Chain C
Resolution	3.00 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	H
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 7m8v , Chain A
Resolution	3.08 Å
Residue indices (Uniprot), coverage	32-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	N
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.15 Å

PDB ID: 7m8v , Chain B
Resolution	3.08 Å
Residue indices (Uniprot), coverage	34-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	P
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 7m8v , Chain C
Resolution	3.08 Å
Residue indices (Uniprot), coverage	34-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	R
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 7m8v , Chain D
Resolution	3.08 Å
Residue indices (Uniprot), coverage	34-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	T
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 7m8v , Chain E
Resolution	3.08 Å
Residue indices (Uniprot), coverage	34-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	E
Structural gaps	Exists
label_asym_ids of heme	V
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 7m8v , Chain F
Resolution	3.08 Å
Residue indices (Uniprot), coverage	34-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	F
Structural gaps	Exists
label_asym_ids of heme	X
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 7m8v , Chain G
Resolution	3.08 Å
Residue indices (Uniprot), coverage	35-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	G
Structural gaps	Exists
label_asym_ids of heme	Z
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 7m8v , Chain H
Resolution	3.08 Å
Residue indices (Uniprot), coverage	34-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	H
Structural gaps	Exists
label_asym_ids of heme	BA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.15 Å

PDB ID: 7m8v , Chain I
Resolution	3.08 Å
Residue indices (Uniprot), coverage	35-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	I
Structural gaps	Exists
label_asym_ids of heme	DA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 7m8v , Chain J
Resolution	3.08 Å
Residue indices (Uniprot), coverage	35-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	J
Structural gaps	Exists
label_asym_ids of heme	FA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 7m8v , Chain K
Resolution	3.08 Å
Residue indices (Uniprot), coverage	34-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	K
Structural gaps	Exists
label_asym_ids of heme	HA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 7m8v , Chain L
Resolution	3.08 Å
Residue indices (Uniprot), coverage	35-502 (31-503), 0.94
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	L
Structural gaps	Exists
label_asym_ids of heme	JA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4zgx , Chain A
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	M
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4zgx , Chain B
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	O
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.09 Å

PDB ID: 4zgx , Chain C
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	Q
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 4zgx , Chain D
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	S
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 4zgx , Chain E
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-502 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	E
Structural gaps	Exists
label_asym_ids of heme	U
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 4zgx , Chain F
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	F
Structural gaps	Exists
label_asym_ids of heme	W
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 4zgx , Chain G
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	G
Structural gaps	Exists
label_asym_ids of heme	Y
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4zgx , Chain H
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	H
Structural gaps	Exists
label_asym_ids of heme	Z
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 4zgx , Chain I
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	I
Structural gaps	Exists
label_asym_ids of heme	AA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 4zgx , Chain J
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	J
Structural gaps	Exists
label_asym_ids of heme	CA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.09 Å

PDB ID: 4zgx , Chain K
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-503 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	K
Structural gaps	Exists
label_asym_ids of heme	EA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 4zgx , Chain L
Resolution	3.20 Å
Residue indices (Uniprot), coverage	34-502 (28-503), 0.95
Difference from Uniprot sequence	expression tag
auth_asym_id	L
Structural gaps	Exists
label_asym_ids of heme	GA
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å