Danish
Uniprot ID:  P19099
  • Protein: Cytochrome P450 11B2, mitochondrial
  • Organism: Human (Homo sapiens)
  • Length: 503
  • Sequence:
    • MALRAKAEVCVAAPWLSLQRARALGTRAARAPRTVLPFEAMPQHPGNRWLRLLQIWREQGYEHLHLEMHQTFQELGPIFRYNLGGPRMVCVMLPEDVEKLQQVDSLHPCRMILEPWVAYRQHRGHKCGVFLLNGPEWRFNRLRLNPDVLSPKAVQRFLPMVDAVARDFSQALKKKVLQNARGSLTLDVQPSIFHYTIEASNLALFGERLGLVGHSPSSASLNFLHALEVMFKSTVQLMFMPRSLSRWISPKVWKEHFEAWDCIFQYGDNCIQKIYQELAFNRPQHYTGIVAELLLKAELSLEAIKANSMELTAGSVDTTAFPLLMTLFELARNPDVQQILRQESLAAAASISEHPQKATTELPLLRAALKETLRLYPVGLFLERVVSSDLVLQNYHIPAGTLVQVFLYSLGRNAALFPRPERYNPQRWLDIRGSGRNFHHVPFGFGMRQCLGRRLAEAEMLLLLHHVLKHFLVETLTQEDIKMVYSFILRPGTSPLLTFRAIN
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  54
PDB ID:  pdb_00004dvq , Chain A 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id A
Missing residues 432ARG-437ASN
Structural gaps Exists
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00004dvq , Chain B 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id B
Missing residues 432ARG-437ASN
Structural gaps Exists
label_asym_ids of heme P
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004dvq , Chain C 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id C
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme S
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004dvq , Chain D 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id D
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme V
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004dvq , Chain E 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 34-509 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id E
Missing residues 431ILE-436ARG
Structural gaps Exists
label_asym_ids of heme Y
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00004dvq , Chain F 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 34-509 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id F
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme BA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00004dvq , Chain G 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id G
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme EA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00004dvq , Chain H 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id H
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme HA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004dvq , Chain I 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id I
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme JA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004dvq , Chain J 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id J
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme LA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004dvq , Chain K 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id K
Missing residues 429LEU-437ASN
Structural gaps Exists
label_asym_ids of heme NA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004dvq , Chain L 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 36-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id L
Missing residues 82ASN-85GLY:431ILE-439HIS
Structural gaps Exists
label_asym_ids of heme QA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004fdh , Chain A 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id A
Missing residues 431ILE-436ARG
Structural gaps Exists
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00004fdh , Chain B 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id B
Missing residues 433GLY-436ARG
Structural gaps Exists
label_asym_ids of heme O
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00004fdh , Chain C 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id C
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme Q
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00004fdh , Chain D 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id D
Missing residues 432ARG-435GLY
Structural gaps Exists
label_asym_ids of heme S
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00004fdh , Chain E 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 34-509 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id E
Missing residues 431ILE-436ARG
Structural gaps Exists
label_asym_ids of heme U
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00004fdh , Chain F 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 34-509 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id F
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme W
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004fdh , Chain G 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id G
Missing residues 431ILE-436ARG
Structural gaps Exists
label_asym_ids of heme Y
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004fdh , Chain H 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id H
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme AA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004fdh , Chain I 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id I
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme CA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004fdh , Chain J 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id J
Missing residues 431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme EA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004fdh , Chain K 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 34-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id K
label_asym_ids of heme GA
Available structure PDB
PDB ID:  pdb_00004fdh , Chain L 
Resolution 2.71 Å
Residue indices (Uniprot), coverage 36-502 (34-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A29K, R30K, A31T, P32S, R33S
Insertions 503insHHHHHH
Deletions A2-R27
Sequence identity to UniProt 0.9895
auth_asym_id L
Missing residues 82ASN-85GLY:431ILE-437ASN
Structural gaps Exists
label_asym_ids of heme IA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00006xz9 , Chain A 
Resolution 2.77 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id A
Missing residues 431ILE-436ARG
Structural gaps Exists
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00006xz9 , Chain B 
Resolution 2.77 Å
Residue indices (Uniprot), coverage 32-504 (28-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00006xz9 , Chain C 
Resolution 2.77 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id C
Missing residues 433GLY-436ARG
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00006xz8 , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id A
Missing residues 432ARG-436ARG
Structural gaps Exists
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00006xz8 , Chain B 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 32-504 (28-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00006xz8 , Chain C 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id C
Missing residues 433GLY-436ARG
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00007m8v , Chain A 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 32-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id A
Missing residues 84GLY-86PRO:432ARG-435GLY
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00007m8v , Chain B 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 34-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id B
Missing residues 84GLY-85GLY:431ILE-435GLY
Structural gaps Exists
label_asym_ids of heme P
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00007m8v , Chain C 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 34-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id C
Missing residues 432ARG-435GLY
Structural gaps Exists
label_asym_ids of heme R
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00007m8v , Chain D 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 34-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id D
Missing residues 430ASP-435GLY
Structural gaps Exists
label_asym_ids of heme T
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00007m8v , Chain E 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 34-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id E
Missing residues 84GLY-86PRO:431ILE-435GLY
Structural gaps Exists
label_asym_ids of heme V
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00007m8v , Chain F 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 34-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id F
Missing residues 84GLY-86PRO:431ILE-435GLY
Structural gaps Exists
label_asym_ids of heme X
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00007m8v , Chain G 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 35-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id G
Missing residues 84GLY-85GLY:431ILE-435GLY
Structural gaps Exists
label_asym_ids of heme Z
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00007m8v , Chain H 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 34-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id H
Missing residues 84GLY-85GLY:431ILE-433GLY
Structural gaps Exists
label_asym_ids of heme BA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00007m8v , Chain I 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 35-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id I
Missing residues 430ASP-435GLY
Structural gaps Exists
label_asym_ids of heme DA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00007m8v , Chain J 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 35-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id J
Missing residues 84GLY-86PRO:430ASP-435GLY
Structural gaps Exists
label_asym_ids of heme FA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00007m8v , Chain K 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 34-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id K
Missing residues 431ILE-435GLY
Structural gaps Exists
label_asym_ids of heme HA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00007m8v , Chain L 
Resolution 3.08 Å
Residue indices (Uniprot), coverage 35-502 (31-503), 0.95
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) T26K, R27K, A28T, A29S, R30S
Insertions 503insHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9896
auth_asym_id L
Missing residues 84GLY-85GLY:430ASP-436ARG
Structural gaps Exists
label_asym_ids of heme JA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00004zgx , Chain A 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id A
Missing residues 432ARG-436ARG
Structural gaps Exists
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004zgx , Chain B 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id B
Missing residues 432ARG-436ARG
Structural gaps Exists
label_asym_ids of heme O
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.07 Å
PDB ID:  pdb_00004zgx , Chain C 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id C
Missing residues 432ARG-436ARG
Structural gaps Exists
label_asym_ids of heme Q
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.08 Å
PDB ID:  pdb_00004zgx , Chain D 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id D
Missing residues 432ARG-436ARG
Structural gaps Exists
label_asym_ids of heme S
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00004zgx , Chain E 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-502 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id E
Missing residues 83LEU-85GLY:432ARG-438PHE
Structural gaps Exists
label_asym_ids of heme U
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00004zgx , Chain F 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id F
Missing residues 84GLY-84GLY:432ARG-436ARG
Structural gaps Exists
label_asym_ids of heme W
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00004zgx , Chain G 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id G
Missing residues 432ARG-436ARG
Structural gaps Exists
label_asym_ids of heme Y
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004zgx , Chain H 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id H
Missing residues 432ARG-436ARG
Structural gaps Exists
label_asym_ids of heme Z
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00004zgx , Chain I 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id I
Missing residues 82ASN-85GLY:432ARG-439HIS
Structural gaps Exists
label_asym_ids of heme AA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00004zgx , Chain J 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id J
Missing residues 83LEU-84GLY:432ARG-436ARG
Structural gaps Exists
label_asym_ids of heme CA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00004zgx , Chain K 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-503 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id K
Missing residues 46GLY-49TRP:432ARG-436ARG
Structural gaps Exists
label_asym_ids of heme EA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004zgx , Chain L 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 34-502 (28-503), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) R27K
Insertions 503insGGRHHHHHH
Deletions L3-G25
Sequence identity to UniProt 0.9979
auth_asym_id L
Missing residues 432ARG-438PHE
Structural gaps Exists
label_asym_ids of heme GA
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å