Danish
Uniprot ID:  P28313
  • Protein: Peroxidase
  • Organism: Arthromyces ramosus
  • Length: 364
  • Sequence:
    • MKLSLFSTFAAVIIGALALPQGPGGGGGSVTCPGGQSTSNSQCCVWFDVLDDLQTNFYQGSKCESPVRKILRIVFHDAIGFSPALTAAGQFGGGGADGSIIAHSNIELAFPANGGLTDTIEALRAVGINHGVSFGDLIQFATAVGMSNCPGSPRLEFLTGRSNSSQPSPPSLIPGPGNTVTAILDRMGDAGFSPDEVVDLLAAHSLASQEGLNSAIFRSPLDSTPQVFDTQFYIETLLKGTTQPGPSLGFAEELSPFPGEFRMRSDALLARDSRTACRWQSMTSSNEVMGQRYRAAMAKMSVLGFDRNALTDCSDVIPSAVSNNAAPVIPGGLTVDDIEVSCPSEPFPEIATASGPLPSLAPAP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  14
PDB ID:  pdb_00002e39 , Chain A 
Resolution 1.30 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002e3a , Chain A 
Resolution 1.30 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002e3b , Chain A 
Resolution 1.30 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001aru , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001arv , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001arw , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001hsr , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001gzb , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001arp , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001arx , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00001ary , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00001ck6 , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00001c8i , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001gza , Chain A 
Resolution 2.06 Å
Residue indices (Uniprot), coverage 9-344 (21-364), 0.95
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB