Danish

Uniprot ID: P28313

Protein: Peroxidase
Organism:
Length: 364
Sequence:

MKLSLFSTFAAVIIGALALPQGPGGGGGSVTCPGGQSTSNSQCCVWFDVLDDLQTNFYQGSKCESPVRKILRIVFHDAIGFSPALTAAGQFGGGGADGSIIAHSNIELAFPANGGLTDTIEALRAVGINHGVSFGDLIQFATAVGMSNCPGSPRLEFLTGRSNSSQPSPPSLIPGPGNTVTAILDRMGDAGFSPDEVVDLLAAHSLASQEGLNSAIFRSPLDSTPQVFDTQFYIETLLKGTTQPGPSLGFAEELSPFPGEFRMRSDALLARDSRTACRWQSMTSSNEVMGQRYRAAMAKMSVLGFDRNALTDCSDVIPSAVSNNAAPVIPGGLTVDDIEVSCPSEPFPEIATASGPLPSLAPAP

Number of chains: 14

PDB ID: 2e39 , Chain A
Resolution	1.30 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 2e3a , Chain A
Resolution	1.30 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 2e3b , Chain A
Resolution	1.30 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 1aru , Chain A
Resolution	1.60 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 1arv , Chain A
Resolution	1.60 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 1arw , Chain A
Resolution	1.60 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 1hsr , Chain A
Resolution	1.60 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1gzb , Chain A
Resolution	1.80 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1arp , Chain A
Resolution	1.90 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1arx , Chain A
Resolution	1.90 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	M
Available structure	PDB

PDB ID: 1ary , Chain A
Resolution	1.90 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	M
Available structure	PDB

PDB ID: 1ck6 , Chain A
Resolution	1.90 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 1c8i , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 1gza , Chain A
Resolution	2.06 Å
Residue indices (Uniprot), coverage	9-344 (21-364), 0.95
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB