Danish
Uniprot ID:  P28314
  • Protein: Peroxidase
  • Organism: Inky cap fungus (Coprinopsis cinerea)
  • Length: 363
  • Sequence:
    • MKLSLLSTFAAVIIGALALPQGPGGGGSVTCPGGQSTSNSQCCVWFDVLDDLQTNFYQGSKCESPVRKILRIVFHDAIGFSPALTAAGQFGGGGADGSIIAHSNIELAFPANGGLTDTVEALRAVGINHGVSFGDLIQFATAVGMSNCPGSPRLEFLTGRSNSSQPSPPSLIPGPGNTVTAILDRMGDAGFSPDEVVDLLAAHSLASQEGLNSAIFRSPLDSTPQVFDTQFYIETLLKGTTQPGPSLGFAEELSPFPGEFRMRSDALLARDSRTACRWQSMTSSNEVMGQRYRAAMAKMSVLGFDRNALTDCSDVIPSAVSNNAAPVIPGGLTVDDIEVSCPSEPFPEIATASGPLPSLAPAP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  10
PDB ID:  pdb_00001lyc , Chain A 
Resolution 1.57 Å
Residue indices (Uniprot), coverage 8-343 (21-363), 0.94
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) N162S, T351A, S358A
Insertions None
Deletions M1-P20
Sequence identity to UniProt 0.9913
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001lyc , Chain B 
Resolution 1.57 Å
Residue indices (Uniprot), coverage 8-343 (21-363), 0.94
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) N162S, T351A, S358A
Insertions None
Deletions M1-P20
Sequence identity to UniProt 0.9913
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001h3j , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 8-343 (22-363), 0.94
Mutations (UniProt numbering) None
Insertions None
Deletions M1-Q21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001h3j , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 8-343 (22-363), 0.94
Mutations (UniProt numbering) None
Insertions None
Deletions M1-Q21
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00001ly9 , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 8-343 (21-363), 0.94
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) N162S, T351A, S358A
Insertions None
Deletions M1-P20
Sequence identity to UniProt 0.9913
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001ly9 , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 8-343 (21-363), 0.94
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) N162S, T351A, S358A
Insertions None
Deletions M1-P20
Sequence identity to UniProt 0.9913
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001lyk , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 8-343 (21-363), 0.94
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001lyk , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 8-343 (21-363), 0.94
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P20
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00001ly8 , Chain A 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 5-343 (21-363), 0.94
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) I69S, V73A, T141A, M186F, E259G, M262I, Y292F
Insertions None
Deletions M1-P20
Sequence identity to UniProt 0.9796
auth_asym_id A
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001ly8 , Chain B 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 6-343 (21-363), 0.94
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) I69S, V73A, T141A, M186F, E259G, M262I, Y292F
Insertions None
Deletions M1-P20
Sequence identity to UniProt 0.9796
auth_asym_id B
label_asym_ids of heme R
Available structure PDB