Danish

Uniprot ID: P28314

Protein: Peroxidase
Organism: Inky cap fungus (Coprinopsis cinerea)
Length: 363
Sequence:

MKLSLLSTFAAVIIGALALPQGPGGGGSVTCPGGQSTSNSQCCVWFDVLDDLQTNFYQGSKCESPVRKILRIVFHDAIGFSPALTAAGQFGGGGADGSIIAHSNIELAFPANGGLTDTVEALRAVGINHGVSFGDLIQFATAVGMSNCPGSPRLEFLTGRSNSSQPSPPSLIPGPGNTVTAILDRMGDAGFSPDEVVDLLAAHSLASQEGLNSAIFRSPLDSTPQVFDTQFYIETLLKGTTQPGPSLGFAEELSPFPGEFRMRSDALLARDSRTACRWQSMTSSNEVMGQRYRAAMAKMSVLGFDRNALTDCSDVIPSAVSNNAAPVIPGGLTVDDIEVSCPSEPFPEIATASGPLPSLAPAP

Number of chains: 10

PDB ID: 1lyc , Chain A
Resolution	1.57 Å
Residue indices (Uniprot), coverage	8-343 (21-363), 0.94
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1lyc , Chain B
Resolution	1.57 Å
Residue indices (Uniprot), coverage	8-343 (21-363), 0.94
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
label_asym_ids of heme	H
Available structure	PDB

PDB ID: 1h3j , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	8-343 (22-363), 0.94
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1h3j , Chain B
Resolution	2.00 Å
Residue indices (Uniprot), coverage	8-343 (22-363), 0.94
auth_asym_id	B
label_asym_ids of heme	J
Available structure	PDB

PDB ID: 1ly9 , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	8-343 (21-363), 0.94
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1ly9 , Chain B
Resolution	2.00 Å
Residue indices (Uniprot), coverage	8-343 (21-363), 0.94
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
label_asym_ids of heme	H
Available structure	PDB

PDB ID: 1lyk , Chain A
Resolution	2.00 Å
Residue indices (Uniprot), coverage	8-343 (21-363), 0.94
auth_asym_id	A
label_asym_ids of heme	H
Available structure	PDB

PDB ID: 1lyk , Chain B
Resolution	2.00 Å
Residue indices (Uniprot), coverage	8-343 (21-363), 0.94
auth_asym_id	B
label_asym_ids of heme	N
Available structure	PDB

PDB ID: 1ly8 , Chain A
Resolution	2.05 Å
Residue indices (Uniprot), coverage	5-343 (21-363), 0.94
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	H
Available structure	PDB

PDB ID: 1ly8 , Chain B
Resolution	2.05 Å
Residue indices (Uniprot), coverage	6-343 (21-363), 0.94
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
label_asym_ids of heme	R
Available structure	PDB