Danish
Uniprot ID:  P35520
  • Protein: Cystathionine beta-synthase
  • Organism: Human (Homo sapiens)
  • Length: 551
  • Sequence:
    • MPSETPQAEVGPTGCPHRSGPHSAKGSLEKGSPEDKEAKEPLWIRPDAPSRCTWQLGRPASESPHHHTAPAKSPKILPDILKKIGDTPMVRINKIGKKFGLKCELLAKCEFFNAGGSVKDRISLRMIEDAERDGTLKPGDTIIEPTSGNTGIGLALAAAVRGYRCIIVMPEKMSSEKVDVLRALGAEIVRTPTNARFDSPESHVGVAWRLKNEIPNSHILDQYRNASNPLAHYDTTADEILQQCDGKLDMLVASVGTGGTITGIARKLKEKCPGCRIIGVDPEGSILAEPEELNQTEQTTYEVEGIGYDFIPTVLDRTVVDKWFKSNDEEAFTFARMLIAQEGLLCGGSAGSTVAVAVKAAQELQEGQRCVVILPDSVRNYMTKFLSDRWMLQKGFLKEEDLTEKKPWWWHLRVQELGLSAPLTVLPTITCGHTIEILREKGFDQAPVVDEAGVILGMVTLGNMLSSLLAGKVQPSDQVGKVIYKQFKQIRLTDTLGRLSHILEMDHFALVVHEQIQYHSTGKSSQRQMVFGVVTAIDLLNFVAAQERDQK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  120
PDB ID:  pdb_00004coo , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 43-548 (1-551), 0.98
Difference from Uniprot sequence deletion:expression tag
Mutations (UniProt numbering) None
Insertions 0insMHHHHHHSSGVDLGTENLYFQS
Deletions I516-S525
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 515GLN-517ARG
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00004coo , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 43-538 (1-551), 0.98
Difference from Uniprot sequence deletion:expression tag
Mutations (UniProt numbering) None
Insertions 0insMHHHHHHSSGVDLGTENLYFQS
Deletions I516-S525
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 398LYS-404GLU:516GLN-517ARG
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00009shm , Chain A 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00009shm , Chain B 
Resolution 2.00 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00009shn , Chain A 
Resolution 2.18 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00009shn , Chain B 
Resolution 2.18 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00008stw , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 44-398 (44-406), 0.66
Difference from Uniprot sequence initiating methionine:variant
Mutations (UniProt numbering) K384N
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 0.9972
auth_asym_id A
Missing residues 194ASN-196ARG
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008stw , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 44-399 (44-406), 0.66
Difference from Uniprot sequence initiating methionine:variant
Mutations (UniProt numbering) K384N
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 0.9972
auth_asym_id B
Missing residues 59PRO-60ALA:194ASN-195ALA
Structural gaps Exists
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008stw , Chain C 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 44-401 (44-406), 0.66
Difference from Uniprot sequence initiating methionine:variant
Mutations (UniProt numbering) K384N
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 0.9972
auth_asym_id C
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00008stw , Chain D 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 44-396 (44-406), 0.66
Difference from Uniprot sequence initiating methionine:variant
Mutations (UniProt numbering) K384N
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 0.9972
auth_asym_id D
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00008stw , Chain E 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 44-397 (44-406), 0.66
Difference from Uniprot sequence initiating methionine:variant
Mutations (UniProt numbering) K384N
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 0.9972
auth_asym_id E
Missing residues 60ALA-62GLU
Structural gaps Exists
label_asym_ids of heme P
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008stw , Chain F 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 44-397 (44-406), 0.66
Difference from Uniprot sequence initiating methionine:variant
Mutations (UniProt numbering) K384N
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 0.9972
auth_asym_id F
Missing residues 198ASP-199SER
Structural gaps Exists
label_asym_ids of heme R
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00009si8 , Chain A 
Resolution 2.47 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00009si8 , Chain B 
Resolution 2.47 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00009si8 , Chain C 
Resolution 2.47 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00009si8 , Chain D 
Resolution 2.47 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00009si8 , Chain E 
Resolution 2.47 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00009si8 , Chain F 
Resolution 2.47 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00001jbq , Chain A 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 43-397 (1-413), 0.75
Mutations (UniProt numbering) M1I
Insertions 0insGIPSETPQAEVGPTSACGVSLG
Deletions V414-K551
Sequence identity to UniProt 0.9976
auth_asym_id A
Missing residues 194ASN-200PRO
Structural gaps Exists
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00001jbq , Chain B 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 43-397 (1-413), 0.75
Mutations (UniProt numbering) M1I
Insertions 0insGIPSETPQAEVGPTSACGVSLG
Deletions V414-K551
Sequence identity to UniProt 0.9976
auth_asym_id B
Missing residues 194ASN-200PRO
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00001jbq , Chain C 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 43-397 (1-413), 0.75
Mutations (UniProt numbering) M1I
Insertions 0insGIPSETPQAEVGPTSACGVSLG
Deletions V414-K551
Sequence identity to UniProt 0.9976
auth_asym_id C
Missing residues 194ASN-200PRO
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00001jbq , Chain D 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 43-397 (1-413), 0.75
Mutations (UniProt numbering) M1I
Insertions 0insGIPSETPQAEVGPTSACGVSLG
Deletions V414-K551
Sequence identity to UniProt 0.9976
auth_asym_id D
Missing residues 194ASN-200PRO
Structural gaps Exists
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00001jbq , Chain E 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 43-399 (1-413), 0.75
Mutations (UniProt numbering) M1I
Insertions 0insGIPSETPQAEVGPTSACGVSLG
Deletions V414-K551
Sequence identity to UniProt 0.9976
auth_asym_id E
Missing residues 194ASN-200PRO
Structural gaps Exists
label_asym_ids of heme O
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00001jbq , Chain F 
Resolution 2.60 Å
Residue indices (Uniprot), coverage 43-397 (1-413), 0.75
Mutations (UniProt numbering) M1I
Insertions 0insGIPSETPQAEVGPTSACGVSLG
Deletions V414-K551
Sequence identity to UniProt 0.9976
auth_asym_id F
Missing residues 194ASN-200PRO
Structural gaps Exists
label_asym_ids of heme Q
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00004l28 , Chain A 
Resolution 2.63 Å
Residue indices (Uniprot), coverage 42-548 (2-551), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) D444N
Insertions 551insLEHHHHHH
Deletions M1
Sequence identity to UniProt 0.9982
auth_asym_id A
Missing residues 402LEU-402LEU:515GLN-527ARG
Structural gaps Exists
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00004l28 , Chain B 
Resolution 2.63 Å
Residue indices (Uniprot), coverage 42-550 (2-551), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) D444N
Insertions 551insLEHHHHHH
Deletions M1
Sequence identity to UniProt 0.9982
auth_asym_id B
Missing residues 297GLU-297GLU:401ASP-401ASP:403THR-403THR:515GLN-526GLN
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00004l28 , Chain C 
Resolution 2.63 Å
Residue indices (Uniprot), coverage 43-549 (2-551), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) D444N
Insertions 551insLEHHHHHH
Deletions M1
Sequence identity to UniProt 0.9982
auth_asym_id C
Missing residues 297GLU-297GLU:401ASP-401ASP:403THR-404GLU:515GLN-526GLN
Structural gaps Exists
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004l28 , Chain D 
Resolution 2.63 Å
Residue indices (Uniprot), coverage 43-549 (2-551), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) D444N
Insertions 551insLEHHHHHH
Deletions M1
Sequence identity to UniProt 0.9982
auth_asym_id D
Missing residues 401ASP-401ASP:403THR-403THR:515GLN-526GLN
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00007qgt , Chain A 
Resolution 2.69 Å
Residue indices (Uniprot), coverage 41-540 (1-551), 0.98
Difference from Uniprot sequence deletion:expression tag:initiating methionine
Mutations (UniProt numbering) None
Insertions 0insMHHHHHHSSGVDLGTENLYFQS
Deletions I516-S525
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007qgt , Chain B 
Resolution 2.69 Å
Residue indices (Uniprot), coverage 41-540 (1-551), 0.98
Difference from Uniprot sequence deletion:expression tag:initiating methionine
Mutations (UniProt numbering) None
Insertions 0insMHHHHHHSSGVDLGTENLYFQS
Deletions I516-S525
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00009sml , Chain A 
Resolution 2.78 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00009sml , Chain B 
Resolution 2.78 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00009sml , Chain C 
Resolution 2.78 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00009sml , Chain D 
Resolution 2.78 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00009sml , Chain E 
Resolution 2.78 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id E
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00009sml , Chain F 
Resolution 2.78 Å
Residue indices (Uniprot), coverage 42-548 (41-550), 0.93
Mutations (UniProt numbering) None
Insertions None
Deletions M1-E40, K551
Sequence identity to UniProt 1.0000
auth_asym_id F
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00005mms , Chain A 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 44-396 (1-408), 0.74
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) P49L
Insertions None
Deletions W409-K551
Sequence identity to UniProt 0.9975
auth_asym_id A
Missing residues 193THR-199SER:295GLN-300THR
Structural gaps Exists
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00005mms , Chain B 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 45-397 (1-408), 0.74
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) P49L
Insertions None
Deletions W409-K551
Sequence identity to UniProt 0.9975
auth_asym_id B
Missing residues 193THR-197PHE
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00005mms , Chain C 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 44-394 (1-408), 0.74
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) P49L
Insertions None
Deletions W409-K551
Sequence identity to UniProt 0.9975
auth_asym_id C
Missing residues 171GLU-173MET:193THR-197PHE
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00005mms , Chain D 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 45-400 (1-408), 0.74
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) P49L
Insertions None
Deletions W409-K551
Sequence identity to UniProt 0.9975
auth_asym_id D
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00005mms , Chain E 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 44-397 (1-408), 0.74
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) P49L
Insertions None
Deletions W409-K551
Sequence identity to UniProt 0.9975
auth_asym_id E
Missing residues 295GLN-299THR
Structural gaps Exists
label_asym_ids of heme P
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00005mms , Chain F 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 44-397 (1-408), 0.74
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) P49L
Insertions None
Deletions W409-K551
Sequence identity to UniProt 0.9975
auth_asym_id F
Missing residues 171GLU-173MET:192PRO-201GLU
Structural gaps Exists
label_asym_ids of heme T
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00001m54 , Chain A 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 47-403 (44-406), 0.66
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) None
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 195ALA-199SER
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.22 Å
PDB ID:  pdb_00001m54 , Chain B 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 45-401 (44-406), 0.66
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) None
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 194ASN-201GLU:397LEU-398LYS
Structural gaps Exists
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.22 Å
PDB ID:  pdb_00001m54 , Chain C 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 47-399 (44-406), 0.66
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) None
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 194ASN-200PRO
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.20 Å
PDB ID:  pdb_00001m54 , Chain D 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 47-399 (44-406), 0.66
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) None
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 194ASN-200PRO
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.23 Å
PDB ID:  pdb_00001m54 , Chain E 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 47-397 (44-406), 0.66
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) None
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 1.0000
auth_asym_id E
Missing residues 194ASN-197PHE
Structural gaps Exists
label_asym_ids of heme P
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.21 Å
PDB ID:  pdb_00001m54 , Chain F 
Resolution 2.90 Å
Residue indices (Uniprot), coverage 45-397 (44-406), 0.66
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) None
Insertions None
Deletions P2-I44, K406-Q550
Sequence identity to UniProt 1.0000
auth_asym_id F
Missing residues 192PRO-200PRO
Structural gaps Exists
label_asym_ids of heme R
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.22 Å
PDB ID:  pdb_00004l0d , Chain A 
Resolution 2.97 Å
Residue indices (Uniprot), coverage 41-550 (1-551), 0.98
Difference from Uniprot sequence deletion:engineered mutation:expression tag
Mutations (UniProt numbering) P2G
Insertions 551insELHHHHHH
Deletions I516-S525
Sequence identity to UniProt 0.9982
auth_asym_id A
Missing residues 402LEU-402LEU:481LYS-481LYS:515GLN-517ARG
Structural gaps Exists
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00004l0d , Chain B 
Resolution 2.97 Å
Residue indices (Uniprot), coverage 41-549 (1-551), 0.98
Difference from Uniprot sequence deletion:engineered mutation:expression tag
Mutations (UniProt numbering) P2G
Insertions 551insELHHHHHH
Deletions I516-S525
Sequence identity to UniProt 0.9982
auth_asym_id B
Missing residues 515GLN-517ARG
Structural gaps Exists
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00009vtf , Chain A 
Resolution 3.03 Å
Residue indices (Uniprot), coverage 43-547 (1-551), 1.00
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) None
Insertions 0insMHHHHHHSSGVDLGTENLYFQS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 119LYS-119LYS:515GLN-526GLN
Structural gaps Exists
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00009vtf , Chain B 
Resolution 3.03 Å
Residue indices (Uniprot), coverage 43-537 (1-551), 1.00
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) None
Insertions 0insMHHHHHHSSGVDLGTENLYFQS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 119LYS-119LYS:398LYS-404GLU:515GLN-527ARG
Structural gaps Exists
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00009vtf , Chain C 
Resolution 3.03 Å
Residue indices (Uniprot), coverage 43-548 (1-551), 1.00
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) None
Insertions 0insMHHHHHHSSGVDLGTENLYFQS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 119LYS-119LYS:515GLN-527ARG
Structural gaps Exists
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00009vtf , Chain D 
Resolution 3.03 Å
Residue indices (Uniprot), coverage 43-538 (1-551), 1.00
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) None
Insertions 0insMHHHHHHSSGVDLGTENLYFQS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 119LYS-119LYS:398LYS-404GLU:516ILE-525SER:518GLN-518GLN
Structural gaps Exists
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004l27 , Chain A 
Resolution 3.39 Å
Residue indices (Uniprot), coverage 42-548 (2-551), 0.98
Difference from Uniprot sequence deletion:engineered mutation:expression tag
Mutations (UniProt numbering) D444N
Insertions 551insLEHHHHHH
Deletions M1, I516-S525
Sequence identity to UniProt 0.9981
auth_asym_id B
Missing residues 402LEU-403THR:452ALA-452ALA:515GLN-518GLN
Structural gaps Exists
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004l27 , Chain B 
Resolution 3.39 Å
Residue indices (Uniprot), coverage 43-548 (2-551), 0.98
Difference from Uniprot sequence deletion:engineered mutation:expression tag
Mutations (UniProt numbering) D444N
Insertions 551insLEHHHHHH
Deletions M1, I516-S525
Sequence identity to UniProt 0.9981
auth_asym_id D
Missing residues 402LEU-402LEU:450ASP-450ASP:515GLN-517ARG
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004l27 , Chain C 
Resolution 3.39 Å
Residue indices (Uniprot), coverage 41-549 (2-551), 0.98
Difference from Uniprot sequence deletion:engineered mutation:expression tag
Mutations (UniProt numbering) D444N
Insertions 551insLEHHHHHH
Deletions M1, I516-S525
Sequence identity to UniProt 0.9981
auth_asym_id A
Missing residues 52CYS-52CYS:59PRO-60ALA:401ASP-403THR:427PRO-428THR:433HIS-433HIS:452ALA-454VAL:478GLN-478GLN:515GLN-516GLN
Structural gaps Exists
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00004l27 , Chain D 
Resolution 3.39 Å
Residue indices (Uniprot), coverage 42-548 (2-551), 0.98
Difference from Uniprot sequence deletion:engineered mutation:expression tag
Mutations (UniProt numbering) D444N
Insertions 551insLEHHHHHH
Deletions M1, I516-S525
Sequence identity to UniProt 0.9981
auth_asym_id C
Missing residues 400GLU-403THR:515GLN-516GLN
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00004pcu , Chain A 
Resolution 3.58 Å
Residue indices (Uniprot), coverage 43-545 (1-551), 0.98
Difference from Uniprot sequence conflict:deletion:engineered mutation:expression tag
Mutations (UniProt numbering) P2G, E201S
Insertions 551insELHHHHHH
Deletions I516-S525
Sequence identity to UniProt 0.9963
auth_asym_id A
Missing residues 193THR-194ASN:403THR-404GLU:515GLN-517ARG
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00004pcu , Chain B 
Resolution 3.58 Å
Residue indices (Uniprot), coverage 43-547 (1-551), 0.98
Difference from Uniprot sequence conflict:deletion:engineered mutation:expression tag
Mutations (UniProt numbering) P2G, E201S
Insertions 551insELHHHHHH
Deletions I516-S525
Sequence identity to UniProt 0.9963
auth_asym_id B
Missing residues 402LEU-407PRO
Structural gaps Exists
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.23 Å
PDB ID:  pdb_00004l3v , Chain A 
Resolution 3.63 Å
Residue indices (Uniprot), coverage 41-550 (2-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 515GLN-526GLN
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 1.11 Å
PDB ID:  pdb_00004l3v , Chain A-1 
Resolution 3.63 Å
Residue indices (Uniprot), coverage 41-550 (2-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 515GLN-526GLN
Structural gaps Exists
label_asym_ids of heme E-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004l3v , Chain B 
Resolution 3.63 Å
Residue indices (Uniprot), coverage 41-550 (2-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 515GLN-526GLN
Structural gaps Exists
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00004l3v , Chain C 
Resolution 3.63 Å
Residue indices (Uniprot), coverage 41-550 (2-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 60ALA-60ALA:515GLN-526GLN
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00009hif , Chain A 
Resolution 3.65 Å
Residue indices (Uniprot), coverage 41-550 (1-551), 0.98
Difference from Uniprot sequence deletion:engineered mutation
Mutations (UniProt numbering) R336C
Insertions None
Deletions I516-S525
Sequence identity to UniProt 0.9982
auth_asym_id A
Missing residues 119LYS-119LYS:481LYS-481LYS:515GLN-516GLN
Structural gaps Exists
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00009hif , Chain B 
Resolution 3.65 Å
Residue indices (Uniprot), coverage 41-550 (1-551), 0.98
Difference from Uniprot sequence deletion:engineered mutation
Mutations (UniProt numbering) R336C
Insertions None
Deletions I516-S525
Sequence identity to UniProt 0.9982
auth_asym_id B
Missing residues 119LYS-119LYS:481LYS-481LYS:515GLN-516GLN
Structural gaps Exists
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008s5h , Chain A 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008s5h , Chain B 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008s5h , Chain C 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008s5h , Chain D 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008s5h , Chain E 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id E
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008s5h , Chain F 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id F
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008s5h , Chain G 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id G
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme O
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008s5h , Chain H 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id H
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme P
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008s5i , Chain A 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008s5i , Chain B 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008s5i , Chain C 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00008s5i , Chain D 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00008s5i , Chain E 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id E
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00008s5i , Chain F 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 551insAAHHHHHH
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id F
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008s5j , Chain A 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008s5j , Chain B 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008s5j , Chain C 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008s5j , Chain D 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008s5j , Chain E 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id E
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme O
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008s5j , Chain F 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id F
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme P
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008s5j , Chain G 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id G
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme Q
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008s5j , Chain H 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id H
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme R
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008s5j , Chain I 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id I
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme S
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008s5j , Chain J 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id J
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme T
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00008s5k , Chain A 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008s5k , Chain B 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008s5k , Chain C 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008s5k , Chain D 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008s5k , Chain E 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id E
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008s5k , Chain F 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id F
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008s5k , Chain G 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id G
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme O
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008s5k , Chain H 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id H
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme P
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008s5l , Chain A 
Residue indices (Uniprot), coverage 42-404 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00008s5l , Chain B 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00008s5l , Chain C 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00008s5l , Chain D 
Residue indices (Uniprot), coverage 42-404 (1-551), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00009spw , Chain A 
Residue indices (Uniprot), coverage 412-550 (1-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 481LYS-481LYS
Structural gaps Exists
label_asym_ids of heme None
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00009spw , Chain B 
Residue indices (Uniprot), coverage 412-550 (1-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 481LYS-481LYS
Structural gaps Exists
label_asym_ids of heme None
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00009spw , Chain C 
Residue indices (Uniprot), coverage 42-550 (1-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 119LYS-119LYS:402LEU-411HIS:481LYS-481LYS
Structural gaps Exists
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00009spw , Chain D 
Residue indices (Uniprot), coverage 42-550 (1-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 119LYS-119LYS:402LEU-411HIS:481LYS-481LYS
Structural gaps Exists
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.17 Å
PDB ID:  pdb_00009spw , Chain E 
Residue indices (Uniprot), coverage 412-550 (1-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id E
Missing residues 481LYS-481LYS
Structural gaps Exists
label_asym_ids of heme None
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00009spw , Chain F 
Residue indices (Uniprot), coverage 412-550 (1-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id F
Missing residues 481LYS-481LYS
Structural gaps Exists
label_asym_ids of heme None
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00009sq0 , Chain A 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00009sq0 , Chain B 
Residue indices (Uniprot), coverage 42-548 (1-551), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00009sqq , Chain A 
Residue indices (Uniprot), coverage 42-548 (42-548), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P41, D549-K551
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00009sqq , Chain B 
Residue indices (Uniprot), coverage 42-548 (42-548), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P41, D549-K551
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00009sqq , Chain C 
Residue indices (Uniprot), coverage 42-548 (42-548), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P41, D549-K551
Sequence identity to UniProt 1.0000
auth_asym_id E
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00009sqq , Chain D 
Residue indices (Uniprot), coverage 42-548 (42-548), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P41, D549-K551
Sequence identity to UniProt 1.0000
auth_asym_id F
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00009sqq , Chain E 
Residue indices (Uniprot), coverage 42-548 (42-548), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P41, D549-K551
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme O
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00009sqq , Chain F 
Residue indices (Uniprot), coverage 42-548 (42-548), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P41, D549-K551
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme P
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00009sqq , Chain G 
Residue indices (Uniprot), coverage 42-548 (42-548), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P41, D549-K551
Sequence identity to UniProt 1.0000
auth_asym_id G
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme Q
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00009sqq , Chain H 
Residue indices (Uniprot), coverage 42-548 (42-548), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P41, D549-K551
Sequence identity to UniProt 1.0000
auth_asym_id H
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme R
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00009sqq , Chain I 
Residue indices (Uniprot), coverage 42-548 (42-548), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P41, D549-K551
Sequence identity to UniProt 1.0000
auth_asym_id I
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme S
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00009sqq , Chain J 
Residue indices (Uniprot), coverage 42-548 (42-548), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1-P41, D549-K551
Sequence identity to UniProt 1.0000
auth_asym_id J
Missing residues 119LYS-119LYS
Nonstandard amino acids LLP Structure of LLPLLP
label_asym_ids of heme T
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å