Danish

Uniprot ID: P38554

Protein: Cytochrome c3, 26 kDa
Organism: Desulfovibrio baculatus (strain Norway 4) (Desulfomicrobium norvegicum (strain DSM 1741 / NCIMB 8310))
Length: 111
Sequence:

ETFEIPESVTMSPKQFEGYTPKKGDVTFNHASHMDIACQQCHHTVPDTYTIESCMTEGCHDNIKERTEISSVYRTFHTTKDSEKSCVGCHRELKRQGPSDAPLACNSCHVQ

Number of chains: 4

PDB ID: 1czj , Chain A
Resolution	2.16 Å
Residue indices (Uniprot), coverage	2-111 (1-111), 1.00
auth_asym_id	A
label_asym_ids of heme	C , D , E , F
Available structure	PDB

PDB ID: 1czj , Chain A-1
Resolution	2.16 Å
Residue indices (Uniprot), coverage	2-111 (1-111), 1.00
auth_asym_id	A
label_asym_ids of heme	C-1 , D-1 , E-1 , F-1
Available structure	PDB

PDB ID: 1aqe , Chain A
Resolution	2.20 Å
Residue indices (Uniprot), coverage	2-111 (1-111), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	C , D , E , F
Available structure	PDB

PDB ID: 1aqe , Chain A-1
Resolution	2.20 Å
Residue indices (Uniprot), coverage	2-111 (1-111), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	A
label_asym_ids of heme	C-1 , D-1 , E-1 , F-1
Available structure	PDB