Danish
Uniprot ID:  P39597
  • Protein: Deferrochelatase
  • Organism: Bacillus subtilis (strain 168)
  • Length: 416
  • Sequence:
    • MSDEQKKPEQIHRRDILKWGAMAGAAVAIGASGLGGLAPLVQTAAKPSKKDEKEEEQIVPFYGKHQAGITTAHQTYVYFAALDVTAKDKSDIITLFRNWTSLTQMLTSGKKMSAEQRNQYLPPQDTGESADLSPSNLTVTFGFGPGFFEKDGKDRFGLKSKKPKHLAALPAMPNDNLDEKQGGGDICIQVCADDEQVAFHALRNLLNQAVGTCEVRFVNKGFLSGGKNGETPRNLFGFKDGTGNQSTKDDTLMNSIVWIQSGEPDWMTGGTYMAFRKIKMFLEVWDRSSLKDQEDTFGRRKSSGAPFGQKKETDPVKLNQIPSNSHVSLAKSTGKQILRRAFSYTEGLDPKTGYMDAGLLFISFQKNPDNQFIPMLKALSAKDALNEYTQTIGSALYACPGGCKKGEYIAQRLLES
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  30
PDB ID:  pdb_00007e5q , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-363 (55-416), 0.87
Difference from Uniprot sequence conflict:initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id A
Missing residues 56GLY-63GLN
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00007e5q , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 2-363 (55-416), 0.87
Difference from Uniprot sequence conflict:initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id B
Missing residues 58LYS-62GLU:119MET-123ASN
Structural gaps Exists
label_asym_ids of heme Z
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00006kmm , Chain A 
Resolution 1.93 Å
Residue indices (Uniprot), coverage 3-363 (55-416), 0.87
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00006kmm , Chain B 
Resolution 1.93 Å
Residue indices (Uniprot), coverage 2-362 (55-416), 0.87
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id B
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00006kmm , Chain C 
Resolution 1.93 Å
Residue indices (Uniprot), coverage 2-362 (55-416), 0.87
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id C
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00006kmm , Chain D 
Resolution 1.93 Å
Residue indices (Uniprot), coverage 2-363 (55-416), 0.87
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id D
Missing residues 59MET-61ALA
Structural gaps Exists
label_asym_ids of heme X
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00006kmm , Chain E 
Resolution 1.93 Å
Residue indices (Uniprot), coverage 3-362 (55-416), 0.87
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id E
label_asym_ids of heme DA
Available structure PDB
PDB ID:  pdb_00006kmm , Chain F 
Resolution 1.93 Å
Residue indices (Uniprot), coverage 1-363 (55-416), 0.87
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id F
label_asym_ids of heme HA
Available structure PDB
PDB ID:  pdb_00007dlk , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-363 (55-416), 0.87
Difference from Uniprot sequence conflict:initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id A
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00007dlk , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 3-363 (55-416), 0.87
Difference from Uniprot sequence conflict:initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id B
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00007dlk , Chain C 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 1-363 (55-416), 0.87
Difference from Uniprot sequence conflict:initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id C
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00007dlk , Chain D 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 2-362 (55-416), 0.87
Difference from Uniprot sequence conflict:initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id D
label_asym_ids of heme Z
Available structure PDB
PDB ID:  pdb_00007dlk , Chain E 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 2-363 (55-416), 0.87
Difference from Uniprot sequence conflict:initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id E
label_asym_ids of heme EA
Available structure PDB
PDB ID:  pdb_00007dlk , Chain F 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 3-362 (55-416), 0.87
Difference from Uniprot sequence conflict:initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id F
label_asym_ids of heme KA
Available structure PDB
PDB ID:  pdb_00007pl0 , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 56-414 (1-416), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K317E, S325P, A330V
Insertions None
Deletions None
Sequence identity to UniProt 0.9928
auth_asym_id A
Missing residues 309GLN-321ILE
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00007pl0 , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 56-414 (1-416), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K317E, S325P, A330V
Insertions None
Deletions None
Sequence identity to UniProt 0.9928
auth_asym_id B
Missing residues 112MET-116GLN:309GLN-321ILE
Structural gaps Exists
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00007pl0 , Chain C 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 56-414 (1-416), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K317E, S325P, A330V
Insertions None
Deletions None
Sequence identity to UniProt 0.9928
auth_asym_id C
Missing residues 114ALA-115GLU:309GLN-321ILE
Structural gaps Exists
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00007pl0 , Chain D 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 56-414 (1-416), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K317E, S325P, A330V
Insertions None
Deletions None
Sequence identity to UniProt 0.9928
auth_asym_id D
Missing residues 112MET-116GLN:317GLU-321ILE
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00006kmn , Chain A 
Resolution 2.44 Å
Residue indices (Uniprot), coverage 3-363 (55-416), 0.87
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006kmn , Chain B 
Resolution 2.44 Å
Residue indices (Uniprot), coverage 1-363 (55-416), 0.87
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00006kmn , Chain C 
Resolution 2.44 Å
Residue indices (Uniprot), coverage 2-363 (55-416), 0.87
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id C
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00006kmn , Chain D 
Resolution 2.44 Å
Residue indices (Uniprot), coverage 1-363 (55-416), 0.87
Difference from Uniprot sequence initiating methionine
Mutations (UniProt numbering) D88E, G146S, K248E, T251S, I259V, V284I
Insertions None
Deletions S2-E54
Sequence identity to UniProt 0.9835
auth_asym_id D
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00007pkx , Chain A 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 56-414 (1-416), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 112MET-116GLN
Structural gaps Exists
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00007pkx , Chain B 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 56-414 (1-416), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 111LYS-116GLN
Structural gaps Exists
label_asym_ids of heme D
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00009u2x , Chain A 
Resolution 2.67 Å
Residue indices (Uniprot), coverage 56-414 (56-414), 0.86
Difference from Uniprot sequence variant
Mutations (UniProt numbering) N244L
Insertions None
Deletions M1-E55, E415-S416
Sequence identity to UniProt 0.9972
auth_asym_id A
Missing residues 112MET-116GLN
Structural gaps Exists
label_asym_ids of heme G
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00009u2x , Chain B 
Resolution 2.67 Å
Residue indices (Uniprot), coverage 56-414 (56-414), 0.86
Difference from Uniprot sequence variant
Mutations (UniProt numbering) N244L
Insertions None
Deletions M1-E55, E415-S416
Sequence identity to UniProt 0.9972
auth_asym_id B
Missing residues 112MET-116GLN
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00009u2x , Chain C 
Resolution 2.67 Å
Residue indices (Uniprot), coverage 56-414 (56-414), 0.86
Difference from Uniprot sequence variant
Mutations (UniProt numbering) N244L
Insertions None
Deletions M1-E55, E415-S416
Sequence identity to UniProt 0.9972
auth_asym_id C
Missing residues 112MET-116GLN
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00009u2x , Chain D 
Resolution 2.67 Å
Residue indices (Uniprot), coverage 56-414 (56-414), 0.86
Difference from Uniprot sequence variant
Mutations (UniProt numbering) N244L
Insertions None
Deletions M1-E55, E415-S416
Sequence identity to UniProt 0.9972
auth_asym_id D
Missing residues 112MET-117ARG
Structural gaps Exists
label_asym_ids of heme J
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00009u2x , Chain E 
Resolution 2.67 Å
Residue indices (Uniprot), coverage 56-414 (56-414), 0.86
Difference from Uniprot sequence variant
Mutations (UniProt numbering) N244L
Insertions None
Deletions M1-E55, E415-S416
Sequence identity to UniProt 0.9972
auth_asym_id E
Missing residues 112MET-116GLN
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00009u2x , Chain F 
Resolution 2.67 Å
Residue indices (Uniprot), coverage 56-414 (56-414), 0.86
Difference from Uniprot sequence variant
Mutations (UniProt numbering) N244L
Insertions None
Deletions M1-E55, E415-S416
Sequence identity to UniProt 0.9972
auth_asym_id F
Missing residues 112MET-116GLN
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å