- Protein: Hemoglobin-1
- Organism: Thick lucine (Phacoides pectinatus)
- Length: 143
- Sequence:
MSLSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLFKGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGDEGAWTAVAGALMGMIRPNM
| Resolution | 1.43 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-142 (2-143), 0.99 |
| Difference from Uniprot sequence | SEE REMARK 999:conflict |
| auth_asym_id | A |
| Nonstandard amino acids | SAC |
| label_asym_ids of heme | C |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.09 Å |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-142 (2-143), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-142 (2-143), 0.99 |
| Difference from Uniprot sequence | SEE REMARK 999 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-142 (2-143), 0.99 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |