Danish
Uniprot ID:  P41260
  • Protein: Hemoglobin-1
  • Organism: Thick lucine (Phacoides pectinatus)
  • Length: 143
  • Sequence:
    • MSLSAAQKDNVKSSWAKASAAWGTAGPEFFMALFDAHDDVFAKFSGLFKGAAKGTVKNTPEMAAQAQSFKGLVSNWVDNLDNAGALEGQCKTFAANHKARGISAGQLEAAFKVLAGFMKSYGGDEGAWTAVAGALMGMIRPNM
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001b0b , Chain A 
Resolution 1.43 Å
Residue indices (Uniprot), coverage 1-142 (2-143), 0.99
Difference from Uniprot sequence conflict:SEE REMARK 999
Mutations (UniProt numbering) K49S, N142D
Insertions None
Deletions M1
Sequence identity to UniProt 0.9859
auth_asym_id A
Missing residues 1SER-1SER
Nonstandard amino acids SAC Structure of SACSAC
label_asym_ids of heme C
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00001flp , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-142 (2-143), 0.99
Mutations (UniProt numbering) S4E, D9S, K12T, K49S, A115S, M138E, R140E, N142D
Insertions None
Deletions M1
Sequence identity to UniProt 0.9437
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001ebt , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-142 (2-143), 0.99
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) K12T, K49S, A115S, M138E, R140E
Insertions None
Deletions M1
Sequence identity to UniProt 0.9648
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001moh , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-142 (2-143), 0.99
Mutations (UniProt numbering) S4E, D9S, K12T, K49S, A115S, M138E, R140E, N142D
Insertions None
Deletions M1
Sequence identity to UniProt 0.9437
auth_asym_id A
label_asym_ids of heme B
Available structure PDB