Danish

Uniprot ID: P47008

Protein: Phosphatidylinositol transfer protein SFH5
Organism: Baker's yeast (Saccharomyces cerevisiae (strain ATCC 204508 / S288c))
Length: 294
Sequence:

MKFDNDSEKQVFDKLKKAIPGIIKEKCAGYDELYGYKLNPEGLTQEEVDKYYDEKIADRLTYKLCKAYQFEYSTIVQNLIDILNWRREFNPLSCAYKEVHNTELQNVGILTFDANGDANKKAVTWNLYGQLVKKKELFQNVDKFVRYRIGLMEKGLSLLDFTSSDNNYMTQVHDYKGVSVWRMDSDIKNCSKTVIGIFQKYYPELLYAKYFVNVPTVFGWVYDLIKKFVDETTRKKFVVLTDGSKLGQYLKDCPYEGYGGKDKKNNLTKQNVTNVHPTEYGLYILQKQIIEDVE

Number of chains: 3

PDB ID: 6w32 , Chain A
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-292 (1-294), 1.00
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	D
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.14 Å

PDB ID: 6w32 , Chain B
Resolution	2.90 Å
Residue indices (Uniprot), coverage	10-291 (1-294), 1.00
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	E
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.16 Å

PDB ID: 6w32 , Chain C
Resolution	2.90 Å
Residue indices (Uniprot), coverage	1-292 (1-294), 1.00
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	F
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.16 Å