Danish
Uniprot ID:  P48775
  • Protein: Tryptophan 2,3-dioxygenase
  • Organism: Human (Homo sapiens)
  • Length: 406
  • Sequence:
    • MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  64
PDB ID:  pdb_00006pyz , Chain A 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006pyz , Chain B 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 38-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
Missing residues 176ASN-179HIS
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00006pyz , Chain C 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 176ASN-178ARG:238PHE-254VAL
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00006pyz , Chain D 
Resolution 2.02 Å
Residue indices (Uniprot), coverage 39-390 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
Missing residues 244LYS-246GLU:339LYS-345SER
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00006ud5 , Chain A 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 39-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006ud5 , Chain B 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 39-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
Missing residues 176ASN-179HIS
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00006ud5 , Chain C 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 175TYR-179HIS:244LYS-248GLU
Structural gaps Exists
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00006ud5 , Chain D 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00008vtq , Chain A 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 40-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
Missing residues 340ALA-344GLY
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00008vtq , Chain B 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 40-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
Missing residues 341GLY-345SER
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00008vtq , Chain C 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 40-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 244LYS-244LYS:341GLY-345SER
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008vtq , Chain D 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 40-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
Missing residues 244LYS-244LYS:340ALA-345SER
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008vug , Chain A 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
Missing residues 343GLY-343GLY
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00008vug , Chain B 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00008vug , Chain C 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 39-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 245GLU-246GLU:341GLY-344GLY
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00008vug , Chain D 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 39-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
Missing residues 244LYS-246GLU:339LYS-345SER
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008w1h , Chain A 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 40-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
Missing residues 340ALA-345SER
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00008w1h , Chain B 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 40-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
Missing residues 176ASN-177ARG:340ALA-346SER
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008w1h , Chain C 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 40-388 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 244LYS-249GLU:339LYS-346SER
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008w1h , Chain D 
Resolution 2.10 Å
Residue indices (Uniprot), coverage 40-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
Missing residues 339LYS-345SER
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00009at2 , Chain A 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
Missing residues 339LYS-345SER
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00009at2 , Chain B 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 40-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
Missing residues 340ALA-345SER
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00009at2 , Chain C 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 40-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 243ALA-248GLU:338SER-345SER
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00009at2 , Chain D 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 40-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
Missing residues 339LYS-346SER
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00008vzv , Chain A 
Resolution 2.29 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id AAA
Missing residues 176ASN-178ARG:340ALA-345SER
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008vzv , Chain B 
Resolution 2.29 Å
Residue indices (Uniprot), coverage 38-389 (18-389), 0.94
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id BBB
Missing residues 176ASN-179HIS:342THR-345SER
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00008vzv , Chain C 
Resolution 2.29 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id CCC
Missing residues 175TYR-178ARG:238PHE-251GLU:338SER-346SER
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00008vzv , Chain D 
Resolution 2.29 Å
Residue indices (Uniprot), coverage 39-390 (18-389), 0.94
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id DDD
Missing residues 244LYS-245GLU:339LYS-345SER
Structural gaps Exists
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00007lu7 , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id AAA
Missing residues 176ASN-178ARG:339LYS-347GLY
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00007lu7 , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 38-389 (18-389), 0.94
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id BBB
Missing residues 172ARG-179HIS:340ALA-349HIS
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00007lu7 , Chain C 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 39-390 (18-389), 0.94
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id CCC
Missing residues 173VAL-179HIS:238PHE-250LYS:339LYS-347GLY
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00007lu7 , Chain D 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 39-388 (18-389), 0.94
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id DDD
Missing residues 339LYS-345SER
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00006pyy , Chain A 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 38-388 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006pyy , Chain B 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 38-381 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
Missing residues 177ARG-178ARG
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00006pyy , Chain C 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 175TYR-178ARG:237GLU-253GLN
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00006pyy , Chain D 
Resolution 2.40 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
Missing residues 340ALA-345SER
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00005tia , Chain A 
Resolution 2.44 Å
Residue indices (Uniprot), coverage 39-381 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
Missing residues 245GLU-250LYS
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00005tia , Chain B 
Resolution 2.44 Å
Residue indices (Uniprot), coverage 39-381 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
Missing residues 171MET-179HIS
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00005tia , Chain C 
Resolution 2.44 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 169GLN-179HIS:238PHE-256GLU
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00005tia , Chain D 
Resolution 2.44 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
Missing residues 244LYS-247SER
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008w2k , Chain A 
Resolution 2.45 Å
Residue indices (Uniprot), coverage 40-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
Missing residues 339LYS-345SER
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008w2k , Chain B 
Resolution 2.45 Å
Residue indices (Uniprot), coverage 40-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
Missing residues 340ALA-345SER
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008w2k , Chain C 
Resolution 2.45 Å
Residue indices (Uniprot), coverage 40-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 246GLU-246GLU:339LYS-346SER
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008w2k , Chain D 
Resolution 2.45 Å
Residue indices (Uniprot), coverage 40-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
Missing residues 244LYS-244LYS:339LYS-345SER
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00005ti9 , Chain A 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 39-388 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00005ti9 , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 38-381 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
Missing residues 173VAL-180TYR
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.21 Å
PDB ID:  pdb_00005ti9 , Chain C 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 40-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 171MET-180TYR:241ILE-256GLU
Structural gaps Exists
label_asym_ids of heme O
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00005ti9 , Chain D 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 39-382 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
Missing residues 244LYS-247SER:338SER-345SER
Structural gaps Exists
label_asym_ids of heme R
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00009b1q , Chain A 
Resolution 2.62 Å
Residue indices (Uniprot), coverage 40-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
Missing residues 339LYS-345SER
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00009b1q , Chain B 
Resolution 2.62 Å
Residue indices (Uniprot), coverage 40-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
Missing residues 339LYS-345SER
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00009b1q , Chain C 
Resolution 2.62 Å
Residue indices (Uniprot), coverage 40-388 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 179HIS-179HIS:240ARG-247SER:339LYS-347GLY
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00009b1q , Chain D 
Resolution 2.62 Å
Residue indices (Uniprot), coverage 40-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
Missing residues 339LYS-345SER
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00006a4i , Chain A 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 40-381 (19-388), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) S2H, G3H, C4H, P5H, F6H, L7H, G8S, N9S, N10G, F11L, G12V, Y13P, T14R, F15G, K16S, K17H, L18M
Insertions 1insGSS
Deletions L389-D406
Sequence identity to UniProt 0.9562
auth_asym_id A
Missing residues 172ARG-182ASP:244LYS-247SER:339LYS-343GLY
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00006a4i , Chain B 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 40-386 (19-388), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) S2H, G3H, C4H, P5H, F6H, L7H, G8S, N9S, N10G, F11L, G12V, Y13P, T14R, F15G, K16S, K17H, L18M
Insertions 1insGSS
Deletions L389-D406
Sequence identity to UniProt 0.9562
auth_asym_id B
Missing residues 169GLN-184PHE:239ILE-252GLU:339LYS-346SER
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00006a4i , Chain C 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 41-382 (19-388), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) S2H, G3H, C4H, P5H, F6H, L7H, G8S, N9S, N10G, F11L, G12V, Y13P, T14R, F15G, K16S, K17H, L18M
Insertions 1insGSS
Deletions L389-D406
Sequence identity to UniProt 0.9562
auth_asym_id C
Missing residues 179HIS-184PHE:244LYS-249GLU:339LYS-345SER
Structural gaps Exists
label_asym_ids of heme L
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.16 Å
PDB ID:  pdb_00006a4i , Chain D 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 40-387 (19-388), 0.96
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) S2H, G3H, C4H, P5H, F6H, L7H, G8S, N9S, N10G, F11L, G12V, Y13P, T14R, F15G, K16S, K17H, L18M
Insertions 1insGSS
Deletions L389-D406
Sequence identity to UniProt 0.9562
auth_asym_id D
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00009b17 , Chain A 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id A
Missing residues 339LYS-345SER
Structural gaps Exists
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00009b17 , Chain B 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 39-391 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id B
Missing residues 339LYS-345SER
Structural gaps Exists
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00009b17 , Chain C 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 39-388 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id C
Missing residues 241ILE-248GLU:339LYS-345SER
Structural gaps Exists
label_asym_ids of heme K
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00009b17 , Chain D 
Resolution 2.65 Å
Residue indices (Uniprot), coverage 39-389 (18-389), 0.94
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) F400E, S401H, S402H, D403H, E404H, S405H, D406H
Insertions None
Deletions S2-K17, Y390-Y399
Sequence identity to UniProt 0.9816
auth_asym_id D
Missing residues 244LYS-245GLU:339LYS-345SER
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00006vbn , Chain A 
Resolution 3.18 Å
Residue indices (Uniprot), coverage 40-383 (18-388), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) K16G, K17S, D396G, S397N, Y399D, F400Y, S401K, S402D, E404D, S405D, D406K
Insertions None
Deletions S2-F15, L389-C395
Sequence identity to UniProt 0.9714
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006vbn , Chain B 
Resolution 3.18 Å
Residue indices (Uniprot), coverage 40-382 (18-388), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) K16G, K17S, D396G, S397N, Y399D, F400Y, S401K, S402D, E404D, S405D, D406K
Insertions None
Deletions S2-F15, L389-C395
Sequence identity to UniProt 0.9714
auth_asym_id B
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00006vbn , Chain C 
Resolution 3.18 Å
Residue indices (Uniprot), coverage 40-384 (18-388), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) K16G, K17S, D396G, S397N, Y399D, F400Y, S401K, S402D, E404D, S405D, D406K
Insertions None
Deletions S2-F15, L389-C395
Sequence identity to UniProt 0.9714
auth_asym_id C
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00006vbn , Chain D 
Resolution 3.18 Å
Residue indices (Uniprot), coverage 40-382 (18-388), 0.95
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) K16G, K17S, D396G, S397N, Y399D, F400Y, S401K, S402D, E404D, S405D, D406K
Insertions None
Deletions S2-F15, L389-C395
Sequence identity to UniProt 0.9714
auth_asym_id D
label_asym_ids of heme L
Available structure PDB