Danish

Uniprot ID: P48775

Protein: Tryptophan 2,3-dioxygenase
Organism: Human (Homo sapiens)
Length: 406
Sequence:

MSGCPFLGNNFGYTFKKLPVEGSEEDKSQTGVNRASKGGLIYGNYLHLEKVLNAQELQSETKGNKIHDEHLFIITHQAYELWFKQILWELDSVREIFQNGHVRDERNMLKVVSRMHRVSVILKLLVQQFSILETMTALDFNDFREYLSPASGFQSLQFRLLENKIGVLQNMRVPYNRRHYRDNFKGEENELLLKSEQEKTLLELVEAWLERTPGLEPHGFNFWGKLEKNITRGLEEEFIRIQAKEESEEKEEQVAEFQKQKEVLLSLFDEKRHEHLLSKGERRLSYRALQGALMIYFYREEPRFQVPFQLLTSLMDIDSLMTKWRYNHVCMVHRMLGSKAGTGGSSGYHYLRSTVSDRYKVFVDLFNLSTYLIPRHWIPKMNPTIHKFLYTAEYCDSSYFSSDESD

Number of chains: 32

PDB ID: 6pyz , Chain A
Resolution	2.02 Å
Residue indices (Uniprot), coverage	39-391 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 6pyz , Chain B
Resolution	2.02 Å
Residue indices (Uniprot), coverage	38-389 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	H
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 6pyz , Chain C
Resolution	2.02 Å
Residue indices (Uniprot), coverage	39-391 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	K
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.15 Å

PDB ID: 6pyz , Chain D
Resolution	2.02 Å
Residue indices (Uniprot), coverage	39-390 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	N
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 6ud5 , Chain A
Resolution	2.05 Å
Residue indices (Uniprot), coverage	39-389 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 6ud5 , Chain B
Resolution	2.05 Å
Residue indices (Uniprot), coverage	39-389 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	I
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 6ud5 , Chain C
Resolution	2.05 Å
Residue indices (Uniprot), coverage	39-391 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	M
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.15 Å

PDB ID: 6ud5 , Chain D
Resolution	2.05 Å
Residue indices (Uniprot), coverage	39-391 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	D
label_asym_ids of heme	Q
Available structure	PDB

PDB ID: 7lu7 , Chain A
Resolution	2.30 Å
Residue indices (Uniprot), coverage	39-391 (18-389), 0.92
auth_asym_id	AAA
Structural gaps	Exists
label_asym_ids of heme	E
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.15 Å

PDB ID: 7lu7 , Chain B
Resolution	2.30 Å
Residue indices (Uniprot), coverage	38-389 (18-389), 0.92
auth_asym_id	BBB
Structural gaps	Exists
label_asym_ids of heme	I
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.14 Å

PDB ID: 7lu7 , Chain C
Resolution	2.30 Å
Residue indices (Uniprot), coverage	39-390 (18-389), 0.92
auth_asym_id	CCC
Structural gaps	Exists
label_asym_ids of heme	K
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 7lu7 , Chain D
Resolution	2.30 Å
Residue indices (Uniprot), coverage	39-388 (18-389), 0.92
auth_asym_id	DDD
Structural gaps	Exists
label_asym_ids of heme	N
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.10 Å

PDB ID: 6pyy , Chain A
Resolution	2.40 Å
Residue indices (Uniprot), coverage	38-388 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 6pyy , Chain B
Resolution	2.40 Å
Residue indices (Uniprot), coverage	38-381 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	H
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 6pyy , Chain C
Resolution	2.40 Å
Residue indices (Uniprot), coverage	39-391 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	K
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.16 Å

PDB ID: 6pyy , Chain D
Resolution	2.40 Å
Residue indices (Uniprot), coverage	39-391 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	N
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 5tia , Chain A
Resolution	2.44 Å
Residue indices (Uniprot), coverage	39-381 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	E
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 5tia , Chain B
Resolution	2.44 Å
Residue indices (Uniprot), coverage	39-381 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	H
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 5tia , Chain C
Resolution	2.44 Å
Residue indices (Uniprot), coverage	39-391 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	K
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 5tia , Chain D
Resolution	2.44 Å
Residue indices (Uniprot), coverage	39-391 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	N
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 5ti9 , Chain A
Resolution	2.50 Å
Residue indices (Uniprot), coverage	39-388 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 5ti9 , Chain B
Resolution	2.50 Å
Residue indices (Uniprot), coverage	38-381 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	K
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.20 Å

PDB ID: 5ti9 , Chain C
Resolution	2.50 Å
Residue indices (Uniprot), coverage	40-391 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	O
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.11 Å

PDB ID: 5ti9 , Chain D
Resolution	2.50 Å
Residue indices (Uniprot), coverage	39-382 (18-389), 0.92
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	R
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 6a4i , Chain A
Resolution	2.65 Å
Residue indices (Uniprot), coverage	40-381 (19-388), 0.91
Difference from Uniprot sequence	expression tag
auth_asym_id	A
Structural gaps	Exists
label_asym_ids of heme	E
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.15 Å

PDB ID: 6a4i , Chain B
Resolution	2.65 Å
Residue indices (Uniprot), coverage	40-386 (19-388), 0.91
Difference from Uniprot sequence	expression tag
auth_asym_id	B
Structural gaps	Exists
label_asym_ids of heme	I
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.16 Å

PDB ID: 6a4i , Chain C
Resolution	2.65 Å
Residue indices (Uniprot), coverage	41-382 (19-388), 0.91
Difference from Uniprot sequence	expression tag
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	L
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.15 Å

PDB ID: 6a4i , Chain D
Resolution	2.65 Å
Residue indices (Uniprot), coverage	40-387 (19-388), 0.91
Difference from Uniprot sequence	expression tag
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	N
Available structure	PDB (not modeled)

PDB ID: 6vbn , Chain A
Resolution	3.18 Å
Residue indices (Uniprot), coverage	40-383 (18-388), 0.91
Difference from Uniprot sequence	expression tag
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 6vbn , Chain B
Resolution	3.18 Å
Residue indices (Uniprot), coverage	40-382 (18-388), 0.91
Difference from Uniprot sequence	expression tag
auth_asym_id	B
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 6vbn , Chain C
Resolution	3.18 Å
Residue indices (Uniprot), coverage	40-384 (18-388), 0.91
Difference from Uniprot sequence	expression tag
auth_asym_id	C
label_asym_ids of heme	I
Available structure	PDB

PDB ID: 6vbn , Chain D
Resolution	3.18 Å
Residue indices (Uniprot), coverage	40-382 (18-388), 0.91
Difference from Uniprot sequence	expression tag
auth_asym_id	D
label_asym_ids of heme	L
Available structure	PDB