- Protein: Cytochrome c-552
- Organism:
- Length: 176
- Sequence:
MFDTMTVTKAAGALIGSLLFLLLMSWAASGIFHVGTSGHGAEGEEHAQAYTYPVESAGGAEGEAVDEGPDFATVLASADPAAGEKVFGKCKACHKLDGNDGVGPHLNGVVGRTVAGVDGFNYSDPMKAHGGDWTPEALQEFLTNPKAVVKGTKMAFAGLPKIEDRANLIAYLEGQQ
| Resolution | 1.33 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-140 (38-176), 0.79 |
| auth_asym_id | X |
| Structural gaps | Exists |
| label_asym_ids of heme | B |
| Available structure | PDB (not modeled) |
| Resolution | 1.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-100 (78-176), 0.56 |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-100 (78-176), 0.56 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-100 (78-176), 0.56 |
| auth_asym_id | C |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.40 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-100 (78-176), 0.56 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-100 (78-176), 0.56 |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-100 (78-176), 0.56 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-100 (78-176), 0.56 |
| auth_asym_id | C |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-100 (78-176), 0.56 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-100 (78-176), 0.56 |
|---|---|
| Difference from Uniprot sequence | SEE REMARK 999 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-100 (78-176), 0.56 |
|---|---|
| Difference from Uniprot sequence | SEE REMARK 999 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-100 (78-176), 0.56 |
|---|---|
| Difference from Uniprot sequence | SEE REMARK 999 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |