- Protein: Hemoglobin subunit beta
- Organism: Red stingray (Hemitrygon akajei)
- Length: 142
- Sequence:
MVKLSEDQEHYIKGVWKDVDHKQITAKALERVFVVYPWTTRLFSKLQGLFSANDIGVQQHADKVQRALGEAIDDLKKVEINFQNLSGKHQEIGVDTQNFKLLGQTFMVELALHYKKTFRPKEHAAAYKFFRLVAEALSSNYH
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | D-1 |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.90 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-141 (2-142), 0.99 |
| auth_asym_id | B |
| label_asym_ids of heme | E-1 |
| Available structure | PDB |