Danish

Uniprot ID: P56779

Protein: Cytochrome b559 subunit alpha
Organism: Mouse-ear cress (Arabidopsis thaliana)
Length: 83
Sequence:

MSGSTGERSFADIITSIRYWVIHSITIPSLFIAGWLFVSTGLAYDVFGSPRPNEYFTESRQGIPLITGRFDSLEQLDEFSRSF

Number of chains: 4

PDB ID: 5mdx , Chain E
Residue indices (Uniprot), coverage	10-81 (1-83), 1.00
auth_asym_id	E
Structural gaps	Exists
label_asym_ids of heme	JC
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.14 Å

PDB ID: 5mdx , Chain T
Residue indices (Uniprot), coverage	10-81 (1-83), 1.00
auth_asym_id	e
Structural gaps	Exists
label_asym_ids of heme	JD
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.13 Å

PDB ID: 7oui , Chain I
Residue indices (Uniprot), coverage	18-83 (1-83), 1.00
auth_asym_id	E
label_asym_ids of heme	BE
Available structure	PDB

PDB ID: 7oui , Chain IA
Residue indices (Uniprot), coverage	18-83 (1-83), 1.00
auth_asym_id	e
label_asym_ids of heme	GL
Available structure	PDB