Danish
Uniprot ID:  P60523
  • Protein: Hemoglobin subunit alpha
  • Organism: Maned wolf (Chrysocyon brachyurus)
  • Length: 141
  • Sequence:
    • VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGKKVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPAVHASLDKFFTAVSTVLTSKYR
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00001fhj , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001fhj , Chain C 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00002b7h , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00002b7h , Chain C 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-141 (1-141), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme I
Available structure PDB