Danish

Uniprot ID: P60523

Protein: Hemoglobin subunit alpha
Organism: Maned wolf (Chrysocyon brachyurus)
Length: 141
Sequence:

VLSPADKTNIKSTWDKIGGHAGDYGGEALDRTFQSFPTTKTYFPHFDLSPGSAQVKAHGKKVADALTTAVAHLDDLPGALSALSDLHAYKLRVDPVNFKLLSHCLLVTLACHHPTEFTPAVHASLDKFFTAVSTVLTSKYR

Number of chains: 4

PDB ID: 1fhj , Chain A
Resolution	1.80 Å
Residue indices (Uniprot), coverage	1-141 (1-141), 1.00
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	A
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1fhj , Chain C
Resolution	1.80 Å
Residue indices (Uniprot), coverage	1-141 (1-141), 1.00
Difference from Uniprot sequence	SEE REMARK 999
auth_asym_id	C
label_asym_ids of heme	G
Available structure	PDB

PDB ID: 2b7h , Chain A
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-141 (1-141), 1.00
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 2b7h , Chain C
Resolution	2.20 Å
Residue indices (Uniprot), coverage	1-141 (1-141), 1.00
auth_asym_id	C
label_asym_ids of heme	I
Available structure	PDB