- Protein: Hemoglobin subunit beta
- Organism: Maned wolf (Chrysocyon brachyurus)
- Length: 146
- Sequence:
VHLTAEEKSLVSGLWGKVNVDEVGGEALGRLLIVYPWTQRFFDSFGDLSTPDAVMSNAKVKAHGKKVLNSFSDGLKNLDNLKGTFAKLSELHCDKLHVDPENFKLLGNVLVCVLAHHFGKEFTPQVQAAYQKVVAGVANALAHKYH
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 2-145 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 2.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-145 (1-146), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | J |
| Available structure | PDB |