- Protein: Cytochrome b559 subunit beta
- Organism: Mouse-ear cress (Arabidopsis thaliana)
- Length: 39
- Sequence:
MTIDRTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR
| Residue indices (Uniprot), coverage | 11-39 (1-39), 1.00 |
|---|---|
| auth_asym_id | F |
| label_asym_ids of heme | JC |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 11-39 (1-39), 1.00 |
|---|---|
| auth_asym_id | f |
| label_asym_ids of heme | JD |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 11-39 (1-39), 1.00 |
|---|---|
| auth_asym_id | F |
| label_asym_ids of heme | BE |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 11-39 (1-39), 1.00 |
|---|---|
| auth_asym_id | f |
| label_asym_ids of heme | GL |
| Available structure | PDB |