Danish

Uniprot ID: P62096

Protein: Cytochrome b559 subunit beta
Organism: Garden pea (Pisum sativum)
Length: 39
Sequence:

MTIDRTYPIFTVRWLAVHGLAVPTVSFLGSISAMQFIQR

Number of chains: 6

PDB ID: 5xnl , Chain J
Residue indices (Uniprot), coverage	10-39 (1-39), 1.00
auth_asym_id	F
label_asym_ids of heme	VG
Available structure	PDB

PDB ID: 5xnl , Chain LA
Residue indices (Uniprot), coverage	10-39 (1-39), 1.00
auth_asym_id	f
label_asym_ids of heme	GQ
Available structure	PDB

PDB ID: 5xnm , Chain J
Residue indices (Uniprot), coverage	10-39 (1-39), 1.00
auth_asym_id	F
label_asym_ids of heme	RG
Available structure	PDB

PDB ID: 5xnm , Chain KA
Residue indices (Uniprot), coverage	10-39 (1-39), 1.00
auth_asym_id	f
label_asym_ids of heme	AQ
Available structure	PDB

PDB ID: 6yp7 , Chain CA
Residue indices (Uniprot), coverage	10-39 (10-39), 0.77
auth_asym_id	F
label_asym_ids of heme	MK
Available structure	PDB

PDB ID: 6yp7 , Chain L
Residue indices (Uniprot), coverage	10-39 (10-39), 0.77
auth_asym_id	f
label_asym_ids of heme	JH
Available structure	PDB