Danish
Uniprot ID:  P62895
  • Protein: Cytochrome c
  • Organism: Pig (Sus scrofa)
  • Length: 105
  • Sequence:
    • MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00008dvx , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
Missing residues 39LYS-39LYS
Nonstandard amino acids ALY Structure of ALYALY
label_asym_ids of heme E
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00008dvx , Chain B 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
Missing residues 39LYS-39LYS
Nonstandard amino acids ALY Structure of ALYALY
label_asym_ids of heme H
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008dvx , Chain C 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 39LYS-39LYS
Nonstandard amino acids ALY Structure of ALYALY
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008dvx , Chain D 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 39LYS-39LYS
Nonstandard amino acids ALY Structure of ALYALY
label_asym_ids of heme O
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å