- Protein: Cytochrome c
- Organism: Pig (Sus scrofa)
- Length: 105
- Sequence:
MGDVEKGKKIFVQKCAQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGFSYTDANKNKGITWGEETLMEYLENPKKYIPGTKMIFAGIKKKGEREDLIAYLKKATNE
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
| auth_asym_id | A |
| Nonstandard amino acids | ALY |
| label_asym_ids of heme | E |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.10 Å |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
| auth_asym_id | B |
| Nonstandard amino acids | ALY |
| label_asym_ids of heme | H |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
| auth_asym_id | C |
| Nonstandard amino acids | ALY |
| label_asym_ids of heme | M |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.12 Å |
| Resolution | 1.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-104 (2-105), 0.99 |
| auth_asym_id | D |
| Nonstandard amino acids | ALY |
| label_asym_ids of heme | O |
| Available structure | PDB and Modeled |
| RMSD of modeled structure from PDB structure | 0.11 Å |