Danish

Uniprot ID: P69891

Protein: Hemoglobin subunit gamma-1
Organism: Human (Homo sapiens)
Length: 147
Sequence:

MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDATKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTAVASALSSRYH

Number of chains: 8

PDB ID: 1i3d , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-146 (2-147), 0.99
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1i3d , Chain A-1
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-146 (2-147), 0.99
auth_asym_id	A
label_asym_ids of heme	C-1
Available structure	PDB

PDB ID: 1i3d , Chain B
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-146 (2-147), 0.99
auth_asym_id	B
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 1i3d , Chain B-1
Resolution	1.70 Å
Residue indices (Uniprot), coverage	1-146 (2-147), 0.99
auth_asym_id	B
label_asym_ids of heme	E-1
Available structure	PDB

PDB ID: 1i3e , Chain A
Resolution	1.86 Å
Residue indices (Uniprot), coverage	1-146 (2-147), 0.99
auth_asym_id	A
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 1i3e , Chain A-1
Resolution	1.86 Å
Residue indices (Uniprot), coverage	1-146 (2-147), 0.99
auth_asym_id	A
label_asym_ids of heme	D-1
Available structure	PDB

PDB ID: 1i3e , Chain B
Resolution	1.86 Å
Residue indices (Uniprot), coverage	1-146 (2-147), 0.99
auth_asym_id	B
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 1i3e , Chain B-1
Resolution	1.86 Å
Residue indices (Uniprot), coverage	1-146 (2-147), 0.99
auth_asym_id	B
label_asym_ids of heme	F-1
Available structure	PDB