Danish

Uniprot ID: P69892

Protein: Hemoglobin subunit gamma-2
Organism: Human (Homo sapiens)
Length: 147
Sequence:

MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH

Number of chains: 12

PDB ID: 7qu4 , Chain A
Resolution	1.66 Å
Residue indices (Uniprot), coverage	3-145 (1-147), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	G
label_asym_ids of heme	E
Available structure	PDB

PDB ID: 7qu4 , Chain B
Resolution	1.66 Å
Residue indices (Uniprot), coverage	2-145 (1-147), 1.00
Difference from Uniprot sequence	engineered mutation
auth_asym_id	H
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 4mqj , Chain B
Resolution	1.80 Å
Residue indices (Uniprot), coverage	1-146 (3-147), 0.99
Difference from Uniprot sequence	expression tag
auth_asym_id	B
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 4mqj , Chain D
Resolution	1.80 Å
Residue indices (Uniprot), coverage	1-146 (3-147), 0.99
Difference from Uniprot sequence	expression tag
auth_asym_id	H
label_asym_ids of heme	N
Available structure	PDB

PDB ID: 4mqj , Chain F
Resolution	1.80 Å
Residue indices (Uniprot), coverage	2-146 (3-147), 0.99
Difference from Uniprot sequence	expression tag
auth_asym_id	D
label_asym_ids of heme	Q
Available structure	PDB

PDB ID: 4mqj , Chain H
Resolution	1.80 Å
Residue indices (Uniprot), coverage	1-146 (3-147), 0.99
Difference from Uniprot sequence	expression tag
auth_asym_id	F
label_asym_ids of heme	T
Available structure	PDB

PDB ID: 4mqk , Chain B
Resolution	2.24 Å
Residue indices (Uniprot), coverage	2-146 (2-147), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	B
label_asym_ids of heme	K
Available structure	PDB

PDB ID: 4mqk , Chain F
Resolution	2.24 Å
Residue indices (Uniprot), coverage	2-146 (2-147), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	F
label_asym_ids of heme	R
Available structure	PDB

PDB ID: 4mqk , Chain D
Resolution	2.24 Å
Residue indices (Uniprot), coverage	2-146 (2-147), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	D
label_asym_ids of heme	O
Available structure	PDB

PDB ID: 4mqk , Chain H
Resolution	2.24 Å
Residue indices (Uniprot), coverage	2-146 (2-147), 0.99
Difference from Uniprot sequence	engineered mutation
auth_asym_id	H
label_asym_ids of heme	U
Available structure	PDB

PDB ID: 1fdh , Chain B
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-146 (2-147), 0.99
auth_asym_id	G
label_asym_ids of heme	F
Available structure	PDB

PDB ID: 1fdh , Chain D
Resolution	2.50 Å
Residue indices (Uniprot), coverage	1-146 (2-147), 0.99
auth_asym_id	H
label_asym_ids of heme	H
Available structure	PDB