Danish
Uniprot ID:  P69892
  • Protein: Hemoglobin subunit gamma-2
  • Organism: Human (Homo sapiens)
  • Length: 147
  • Sequence:
    • MGHFTEEDKATITSLWGKVNVEDAGGETLGRLLVVYPWTQRFFDSFGNLSSASAIMGNPKVKAHGKKVLTSLGDAIKHLDDLKGTFAQLSELHCDKLHVDPENFKLLGNVLVTVLAIHFGKEFTPEVQASWQKMVTGVASALSSRYH
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  12
PDB ID:  pdb_00007qu4 , Chain A 
Resolution 1.66 Å
Residue indices (Uniprot), coverage 3-145 (1-147), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id G
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00007qu4 , Chain B 
Resolution 1.66 Å
Residue indices (Uniprot), coverage 2-145 (1-147), 1.00
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id H
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00004mqj , Chain B 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-146 (3-147), 0.99
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) G2V
Insertions None
Deletions M1
Sequence identity to UniProt 0.9932
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00004mqj , Chain D 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-146 (3-147), 0.99
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) G2V
Insertions None
Deletions M1
Sequence identity to UniProt 0.9932
auth_asym_id H
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00004mqj , Chain F 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 2-146 (3-147), 0.99
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) G2V
Insertions None
Deletions M1
Sequence identity to UniProt 0.9932
auth_asym_id D
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00004mqj , Chain H 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 1-146 (3-147), 0.99
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) G2V
Insertions None
Deletions M1
Sequence identity to UniProt 0.9932
auth_asym_id F
label_asym_ids of heme T
Available structure PDB
PDB ID:  pdb_00004mqk , Chain B 
Resolution 2.24 Å
Residue indices (Uniprot), coverage 2-146 (2-147), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V68M
Insertions None
Deletions M1
Sequence identity to UniProt 0.9932
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00004mqk , Chain D 
Resolution 2.24 Å
Residue indices (Uniprot), coverage 2-146 (2-147), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V68M
Insertions None
Deletions M1
Sequence identity to UniProt 0.9932
auth_asym_id D
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00004mqk , Chain F 
Resolution 2.24 Å
Residue indices (Uniprot), coverage 2-146 (2-147), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V68M
Insertions None
Deletions M1
Sequence identity to UniProt 0.9932
auth_asym_id F
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00004mqk , Chain H 
Resolution 2.24 Å
Residue indices (Uniprot), coverage 2-146 (2-147), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) V68M
Insertions None
Deletions M1
Sequence identity to UniProt 0.9932
auth_asym_id H
label_asym_ids of heme U
Available structure PDB
PDB ID:  pdb_00001fdh , Chain B 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 1.00
Mutations (UniProt numbering) M1X
Insertions None
Deletions None
Sequence identity to UniProt 0.9932
auth_asym_id G
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001fdh , Chain D 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 1-146 (2-147), 1.00
Mutations (UniProt numbering) M1X
Insertions None
Deletions None
Sequence identity to UniProt 0.9932
auth_asym_id H
label_asym_ids of heme H
Available structure PDB