Danish
Uniprot ID:  P71119
  • Protein: Heme oxygenase
  • Organism: Corynebacterium diphtheriae (strain ATCC 700971 / NCTC 13129 / Biotype gravis)
  • Length: 215
  • Sequence:
    • MTTATAGLAVELKQSTAQAHEKAEHSTFMSDLLEGRLGVAEFTRLQEQAWLFYTALEQAADAVRASGFAESLLDPALNRAEVLARDLDKLNDGSEWRSRITASPAVIDYVNRLEEIRDNVDGPALVAHHYVRYLGDLSGGQVIARMMQRHYGVDPEALGFYHFEGIAKLKVYKDEYREKLNNLELSDEQRENLLKEATDAFVFNHQVFADLGKGL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  17
PDB ID:  pdb_00001iw0 , Chain A 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 7-213 (1-215), 1.00
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9767
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001iw0 , Chain B 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 307-515 (1-215), 1.00
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9767
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00001iw0 , Chain C 
Resolution 1.40 Å
Residue indices (Uniprot), coverage 607-813 (1-215), 1.00
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9767
auth_asym_id C
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00001iw1 , Chain A 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 2-213 (1-215), 1.00
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9767
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001iw1 , Chain B 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 307-515 (1-215), 1.00
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9767
auth_asym_id B
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00001iw1 , Chain C 
Resolution 1.50 Å
Residue indices (Uniprot), coverage 606-813 (1-215), 1.00
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9767
auth_asym_id C
label_asym_ids of heme Q
Available structure PDB
PDB ID:  pdb_00001wnw , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 6-213 (1-215), 1.00
Difference from Uniprot sequence engineered mutation:SEE REMARK 999
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, D136N, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9721
auth_asym_id A
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00001wnw , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 6-215 (1-215), 1.00
Difference from Uniprot sequence engineered mutation:SEE REMARK 999
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, D136N, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9721
auth_asym_id B
label_asym_ids of heme W
Available structure PDB
PDB ID:  pdb_00001wnw , Chain C 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 7-212 (1-215), 1.00
Difference from Uniprot sequence engineered mutation:SEE REMARK 999
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, D136N, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9721
auth_asym_id C
label_asym_ids of heme CA
Available structure PDB
PDB ID:  pdb_00001v8x , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 5-214 (1-215), 1.00
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9767
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001v8x , Chain B 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 307-515 (1-215), 1.00
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9767
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00001v8x , Chain C 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 606-813 (1-215), 1.00
Difference from Uniprot sequence SEE REMARK 999
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9767
auth_asym_id C
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00001wnv , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 7-213 (1-215), 1.00
Difference from Uniprot sequence engineered mutation:SEE REMARK 999
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, D136A, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9721
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001wnv , Chain B 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 306-515 (1-215), 1.00
Difference from Uniprot sequence engineered mutation:SEE REMARK 999
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, D136A, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9721
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00001wnv , Chain C 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 607-813 (1-215), 1.00
Difference from Uniprot sequence engineered mutation:SEE REMARK 999
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, D136A, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9721
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00001wnx , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 7-213 (1-215), 1.00
Difference from Uniprot sequence engineered mutation:SEE REMARK 999
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, D136E, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9721
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00001wnx , Chain B 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 3-212 (1-215), 1.00
Difference from Uniprot sequence engineered mutation:SEE REMARK 999
Mutations (UniProt numbering) E34K, A60V, D92G, G93S, D136E, N192H
Insertions None
Deletions None
Sequence identity to UniProt 0.9721
auth_asym_id B
label_asym_ids of heme P
Available structure PDB