Danish
Uniprot ID:  P82599
  • Protein: Cytochrome c-553
  • Organism: Bacillus pasteurii (Sporosarcina pasteurii)
  • Length: 92
  • Sequence:
    • GGGNDTSNETDTGTSGGETAAVDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  5
PDB ID:  pdb_00001c75 , Chain A 
Resolution 0.97 Å
Residue indices (Uniprot), coverage 22-92 (22-92), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions G1-A21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001b7v , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 22-92 (22-92), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions G1-A21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001k3g , Chain A 
Residue indices (Uniprot), coverage 22-92 (22-92), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions G1-A21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001k3h , Chain A 
Residue indices (Uniprot), coverage 22-92 (22-92), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions G1-A21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001n9c , Chain A 
Residue indices (Uniprot), coverage 22-92 (22-92), 0.77
Mutations (UniProt numbering) None
Insertions None
Deletions G1-A21
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB