Danish

Uniprot ID: P82599

Protein: Cytochrome c-553
Organism: Bacillus pasteurii (Sporosarcina pasteurii)
Length: 92
Sequence:

GGGNDTSNETDTGTSGGETAAVDAEAVVQQKCISCHGGDLTGASAPAIDKAGANYSEEEILDIILNGQGGMPGGIAKGAEAEAVAAWLAEKK

Number of chains: 5

PDB ID: 1c75 , Chain A
Resolution	0.97 Å
Residue indices (Uniprot), coverage	22-92 (22-92), 0.77
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1b7v , Chain A
Resolution	1.70 Å
Residue indices (Uniprot), coverage	22-92 (22-92), 0.77
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1k3g , Chain A
Residue indices (Uniprot), coverage	22-92 (22-92), 0.77
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1k3h , Chain A
Residue indices (Uniprot), coverage	22-92 (22-92), 0.77
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 1n9c , Chain A
Residue indices (Uniprot), coverage	22-92 (22-92), 0.77
auth_asym_id	A
label_asym_ids of heme	B
Available structure	PDB