Danish
Uniprot ID:  P82903
  • Protein: Cytochrome c-552
  • Organism: Marinobacter hydrocarbonoclasticus (Marinobacter nauticus)
  • Length: 88
  • Sequence:
    • AGDIEAGKAKAAVCAACHGQNGISQVPIYPNLAGQKEQYLVAALKAYKAGQRQGGQAPVMQGQATALSDADIANLAAYYASLPADGQG
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  8
PDB ID:  pdb_00001cno , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-86 (1-84), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) L82N, G86A, Q87A, G88A
Insertions None
Deletions D85
Sequence identity to UniProt 0.9540
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00001cno , Chain B 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-86 (1-84), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) L82N, G86A, Q87A, G88A
Insertions None
Deletions D85
Sequence identity to UniProt 0.9540
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00001cno , Chain C 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-86 (1-84), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) L82N, G86A, Q87A, G88A
Insertions None
Deletions D85
Sequence identity to UniProt 0.9540
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00001cno , Chain D 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-86 (1-84), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) L82N, G86A, Q87A, G88A
Insertions None
Deletions D85
Sequence identity to UniProt 0.9540
auth_asym_id D
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00001cno , Chain E 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-86 (1-84), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) L82N, G86A, Q87A, G88A
Insertions None
Deletions D85
Sequence identity to UniProt 0.9540
auth_asym_id E
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00001cno , Chain F 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-86 (1-84), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) L82N, G86A, Q87A, G88A
Insertions None
Deletions D85
Sequence identity to UniProt 0.9540
auth_asym_id F
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00001cno , Chain G 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-87 (1-84), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) L82N, G86A, Q87A, G88A
Insertions None
Deletions D85
Sequence identity to UniProt 0.9540
auth_asym_id G
label_asym_ids of heme R
Available structure PDB
PDB ID:  pdb_00001cno , Chain H 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 1-86 (1-84), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) L82N, G86A, Q87A, G88A
Insertions None
Deletions D85
Sequence identity to UniProt 0.9540
auth_asym_id H
label_asym_ids of heme S
Available structure PDB