- Protein: Hemoglobin beta chain
- Organism: Wild turkey (Meleagris gallopavo)
- Length: 146
- Sequence:
VHWSAEEKQLITGLWGKVNVADCGAEALARLLIVYPWTQRFFASFGNLSSPTAILGNPMVRAHGKKVLTSFGDAVKNLDNIKNTFSQLSELHCDKLHVDPENFRLLGDILIIVLAAHFSKDFTPECQAAWQKLVRVVAHALARKYH
| Resolution | 1.39 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 1.39 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | F |
| Available structure | PDB |
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-146 (1-146), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | H |
| Available structure | PDB |