Danish
Uniprot ID:  P99999
  • Protein: Cytochrome c
  • Organism: Human (Homo sapiens)
  • Length: 105
  • Sequence:
    • MGDVEKGKKIFIMKCSQCHTVEKGGKHKTGPNLHGLFGRKTGQAPGYSYTAANKNKGIIWGEDTLMEYLENPKKYIPGTKMIFVGIKKKEERADLIAYLKKATNE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  35
PDB ID:  pdb_00005ty3 , Chain A 
Resolution 1.25 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K73A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005ty3 , Chain B 
Resolution 1.25 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) K73A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id B
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003zoo , Chain A 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y47F
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003zoo , Chain B 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y47F
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id B
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00003zoo , Chain C 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y47F
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id C
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00003zoo , Chain D 
Resolution 1.35 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y47F
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id D
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00005o10 , Chain A 
Resolution 1.36 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y49H
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005o10 , Chain B 
Resolution 1.36 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y49H
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00005exq , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y49H
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00005exq , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) Y49H
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003zcf , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003zcf , Chain B 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003zcf , Chain C 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003zcf , Chain D 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00006duj , Chain A 
Resolution 1.82 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence variant
Mutations (UniProt numbering) A52V
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00006duj , Chain B 
Resolution 1.82 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) A52V
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id C
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00003nwv , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42S
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00003nwv , Chain B 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42S
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id B
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00003nwv , Chain C 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42S
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id C
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00003nwv , Chain D 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42S
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id D
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00006xnk , Chain A 
Resolution 2.08 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K73A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00006xnk , Chain B 
Resolution 2.08 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) K73A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id C
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00006xnk , Chain C 
Resolution 2.08 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) K73A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id E
label_asym_ids of heme G
Available structure PDB
PDB ID:  pdb_00006xnk , Chain D 
Resolution 2.08 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) K73A
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id G
label_asym_ids of heme H
Available structure PDB
PDB ID:  pdb_00006ecj , Chain A 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00006ecj , Chain B 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00006ecj , Chain C 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id C
label_asym_ids of heme K
Available structure PDB
PDB ID:  pdb_00006ecj , Chain D 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id D
label_asym_ids of heme L
Available structure PDB
PDB ID:  pdb_00006ecj , Chain E 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id E
label_asym_ids of heme M
Available structure PDB
PDB ID:  pdb_00006ecj , Chain F 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id F
label_asym_ids of heme N
Available structure PDB
PDB ID:  pdb_00006ecj , Chain G 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id G
label_asym_ids of heme O
Available structure PDB
PDB ID:  pdb_00006ecj , Chain H 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) G42T
Insertions None
Deletions M1
Sequence identity to UniProt 0.9904
auth_asym_id H
label_asym_ids of heme P
Available structure PDB
PDB ID:  pdb_00001j3s , Chain A 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002n9i , Chain A 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002n9j , Chain A 
Residue indices (Uniprot), coverage 1-104 (2-105), 0.99
Mutations (UniProt numbering) None
Insertions None
Deletions M1
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB