- Protein: Cytochrome c6
- Organism: Green alga (Chlorolobion braunii)
- Length: 89
- Sequence:
EADLALGKAVFDGNCAACHAGGGNNVIPDHTLQKAAIEQFLDGGFNIEAIVYQIENGKGAMPAWDGRLDEDEIAGVAAYVYDQAAGNKW
| Resolution | 1.10 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-89 (1-89), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-89 (1-89), 1.00 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 1-89 (1-89), 1.00 |
|---|---|
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |