- Protein: Cytochrome protein c1
- Organism:
- Length: 319
- Sequence:
MKSFVAAGIIGLSLANSQNKEVQNFIYRDDIGAFWGIKGYEELVTEVGTHKGHNYWPQFSFLGTYDSGSVRRGFQVFARNCGNCHGMIYKKYDYLLDKAYRQLELAQMVSDFTIHPAHQHFKQYYYQEWDERDRVICDHIYPPYFSQDQAKNANGGVWPTDFSKIKLRPGGINYIYNISTGYHFTPPFGMDVPKGKYFNPYFDHMIIGMPRQLVDGLVDYDDGTPASTPQMAYDVSNFINFMQRRVGYKRPDKMVRYYMVFTGGLLILPFKYFKTKAYYRNLLSLRWEMYAVRDGVYYNHFKYGGYNSRAYQFRGYFWA
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | 3D |
| label_asym_ids of heme | AD |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 35-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | 3d |
| label_asym_ids of heme | YD |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | D |
| label_asym_ids of heme | MA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | d |
| label_asym_ids of heme | HB |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | D |
| label_asym_ids of heme | NL |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | d |
| label_asym_ids of heme | IM |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | qD |
| label_asym_ids of heme | WS |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | QD |
| label_asym_ids of heme | QCA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | qd |
| label_asym_ids of heme | UT |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | Qd |
| label_asym_ids of heme | ODA |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | qD |
| label_asym_ids of heme | WQ |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | QD |
| label_asym_ids of heme | TR |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | qd |
| label_asym_ids of heme | BR |
| Available structure | PDB |
| Residue indices (Uniprot), coverage | 25-319 (1-319), 1.00 |
|---|---|
| auth_asym_id | Qd |
| label_asym_ids of heme | YR |
| Available structure | PDB |