Danish
Uniprot ID:  Q2TV05
  • Protein: C-type cytochrome c552
  • Organism: Pseudorhizobium banfieldiae
  • Length: 127
  • Sequence:
    • MRKLFSIVSLCLIAASPAMAESNAEKGAVVFKKCAACHAVGDGAANKVGPELNGLIGRKVAGVEGFNYSPAFKAKAEEGWVWDEVHLTEYLANPKAYIKGTKMAFAGLKKPEDVADVIAYLKTFSTP
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  4
PDB ID:  pdb_00008ed4 , Chain C 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 22-126 (21-127), 0.86
Mutations (UniProt numbering) A20D
Insertions 127insLEHHHHHH
Deletions M1-A18
Sequence identity to UniProt 0.9908
auth_asym_id I
label_asym_ids of heme S
Available structure PDB
PDB ID:  pdb_00008ed4 , Chain F 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 23-124 (21-127), 0.86
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) A20D
Insertions 127insLEHHHHHH
Deletions M1-A18
Sequence identity to UniProt 0.9908
auth_asym_id J
label_asym_ids of heme Z
Available structure PDB
PDB ID:  pdb_00008ed4 , Chain I 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 22-124 (21-127), 0.86
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) A20D
Insertions 127insLEHHHHHH
Deletions M1-A18
Sequence identity to UniProt 0.9908
auth_asym_id K
label_asym_ids of heme IA
Available structure PDB
PDB ID:  pdb_00008ed4 , Chain L 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 23-124 (21-127), 0.86
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) A20D
Insertions 127insLEHHHHHH
Deletions M1-A18
Sequence identity to UniProt 0.9908
auth_asym_id L
label_asym_ids of heme QA
Available structure PDB