- Protein: C-type cytochrome c552
- Organism:
- Length: 127
- Sequence:
MRKLFSIVSLCLIAASPAMAESNAEKGAVVFKKCAACHAVGDGAANKVGPELNGLIGRKVAGVEGFNYSPAFKAKAEEGWVWDEVHLTEYLANPKAYIKGTKMAFAGLKKPEDVADVIAYLKTFSTP
| Resolution | 2.25 Å |
|---|---|
| Residue indices (Uniprot), coverage | 22-126 (19-19), 0.01 |
| auth_asym_id | I |
| label_asym_ids of heme | S |
| Available structure | PDB |
| Resolution | 2.25 Å |
|---|---|
| Residue indices (Uniprot), coverage | 23-124 (19-19), 0.01 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | J |
| label_asym_ids of heme | Z |
| Available structure | PDB |
| Resolution | 2.25 Å |
|---|---|
| Residue indices (Uniprot), coverage | 22-124 (19-19), 0.01 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | K |
| label_asym_ids of heme | IA |
| Available structure | PDB |
| Resolution | 2.25 Å |
|---|---|
| Residue indices (Uniprot), coverage | 23-124 (19-19), 0.01 |
| Difference from Uniprot sequence | expression tag:initiating methionine |
| auth_asym_id | L |
| label_asym_ids of heme | QA |
| Available structure | PDB |