Danish
Uniprot ID:  Q2YKI4
  • Protein: Bacterioferritin
  • Organism: Brucella abortus (strain 2308)
  • Length: 161
  • Sequence:
    • MKGEPKVIERLNEALFLELGAVNQYWLHYRLLNDWGYTRLAKKEREESIEEMHHADKLIDRIIFLEGFPNLQTVSPLRIGQNVKEVLEADLKGEYDARASYKESREICDKLGDYVSKQLFDELLADEEGHIDFLETQLDLLAKIGGERYGQLNAAPADEAE
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  144
PDB ID:  pdb_00008sqo , Chain A 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-1 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-10 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-10
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-11 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-11
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-12 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqo , Chain A-13 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqo , Chain A-14 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-3
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-15 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-2
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-16 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-10
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqo , Chain A-17 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-11
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-18 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-9
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-19 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-8
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqo , Chain A-2 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-2
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-20 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-7
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqo , Chain A-21 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-6
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqo , Chain A-22 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-4
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-23 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-5
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqo , Chain A-3 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-3
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00008sqo , Chain A-4 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-4
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqo , Chain A-5 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-5
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-6 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-6
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-7 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-7
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqo , Chain A-8 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-8
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqo , Chain A-9 
Resolution 1.55 Å
Residue indices (Uniprot), coverage 1-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-76PRO
Structural gaps Exists
label_asym_ids of heme I-9
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqr , Chain A 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqr , Chain A-1 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqr , Chain A-10 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-10
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.15 Å
PDB ID:  pdb_00008sqr , Chain A-11 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-11
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqr , Chain A-12 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqr , Chain A-13 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqr , Chain A-14 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-3
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqr , Chain A-15 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-2
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqr , Chain A-16 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-10
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqr , Chain A-17 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-11
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqr , Chain A-18 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-9
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqr , Chain A-19 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-8
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqr , Chain A-2 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-2
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqr , Chain A-20 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-7
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqr , Chain A-21 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-6
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqr , Chain A-22 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-4
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqr , Chain A-23 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-5
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqr , Chain A-3 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-3
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqr , Chain A-4 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-4
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqr , Chain A-5 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-5
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00008sqr , Chain A-6 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-6
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqr , Chain A-7 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-7
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqr , Chain A-8 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-8
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqr , Chain A-9 
Resolution 1.65 Å
Residue indices (Uniprot), coverage 1-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 77LEU-77LEU
Structural gaps Exists
label_asym_ids of heme O-9
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00003fvb , Chain A 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003fvb , Chain A-1 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00003fvb , Chain A-10 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-10
Available structure PDB
PDB ID:  pdb_00003fvb , Chain A-11 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-11
Available structure PDB
PDB ID:  pdb_00003fvb , Chain A-2 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-2
Available structure PDB
PDB ID:  pdb_00003fvb , Chain A-3 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-3
Available structure PDB
PDB ID:  pdb_00003fvb , Chain A-4 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-4
Available structure PDB
PDB ID:  pdb_00003fvb , Chain A-5 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-5
Available structure PDB
PDB ID:  pdb_00003fvb , Chain A-6 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-6
Available structure PDB
PDB ID:  pdb_00003fvb , Chain A-7 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-7
Available structure PDB
PDB ID:  pdb_00003fvb , Chain A-8 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-8
Available structure PDB
PDB ID:  pdb_00003fvb , Chain A-9 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-9
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B-1 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C-1
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B-10 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C-10
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B-11 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C-11
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B-2 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C-2
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B-3 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C-3
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B-4 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C-4
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B-5 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C-5
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B-6 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C-6
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B-7 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C-7
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B-8 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C-8
Available structure PDB
PDB ID:  pdb_00003fvb , Chain B-9 
Resolution 1.81 Å
Residue indices (Uniprot), coverage -1-159 (1-161), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insMAHHHHHHMGTLEAQTQGPGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C-9
Available structure PDB
PDB ID:  pdb_00008sqp , Chain A 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqp , Chain A-1 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-10 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-10
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-11 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-11
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqp , Chain A-12 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-13 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-1
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqp , Chain A-14 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-3
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-15 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-2
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-16 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-10
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-17 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-11
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-18 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-9
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-19 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-8
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-2 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-2
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-20 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-7
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-21 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-6
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-22 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-4
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-23 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-5
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-3 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-3
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-4 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-4
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-5 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-5
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-6 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-6
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqp , Chain A-7 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-7
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqp , Chain A-8 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-8
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.14 Å
PDB ID:  pdb_00008sqp , Chain A-9 
Resolution 2.05 Å
Residue indices (Uniprot), coverage 2-160 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
Missing residues 75SER-75SER
Structural gaps Exists
label_asym_ids of heme F-9
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.13 Å
PDB ID:  pdb_00008sqt , Chain A 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-1 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-1
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-10 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-10
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-11 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-11
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-12 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-13 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-1
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-14 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-3
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-15 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-2
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-16 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-10
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-17 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-11
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-18 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-9
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-19 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-8
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-2 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-2
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-20 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-7
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-21 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-6
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-22 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-4
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-23 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-5
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-3 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-3
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-4 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-4
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-5 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-5
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-6 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-6
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-7 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-7
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-8 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-8
Available structure PDB
PDB ID:  pdb_00008sqt , Chain A-9 
Resolution 2.20 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme I-9
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-1 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-1
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-10 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-10
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-11 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-11
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-12 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-13 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-1
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-14 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-3
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-15 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-2
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-16 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-10
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-17 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-11
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-18 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-9
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-19 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-8
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-2 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-2
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-20 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-7
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-21 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-6
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-22 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-4
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-23 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-5
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-3 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-3
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-4 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-4
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-5 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-5
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-6 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-6
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-7 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-7
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-8 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-8
Available structure PDB
PDB ID:  pdb_00008sqq , Chain A-9 
Resolution 2.25 Å
Residue indices (Uniprot), coverage 0-159 (1-161), 1.00
Difference from Uniprot sequence engineered mutation:expression tag
Mutations (UniProt numbering) F16L
Insertions 0insGPGS
Deletions None
Sequence identity to UniProt 0.9938
auth_asym_id A
label_asym_ids of heme F-9
Available structure PDB