- Protein: Nerve hemoglobin
- Organism: Atlantic surf-clam (Spisula solidissima)
- Length: 162
- Sequence:
MADPCPVTKLTKAEKDAVANSWAALKQDWKTIGADFFVKLFETYPNIKAYFKSFDNMDMSEIKQSPKLRAHSINFCHGLNSFIQSLDEPDVLVILVQKLTVNHFRRKIAVDRFQEAFALYVSYAQDHAKFDDFTAAAWTKTLKVVADVIGGHMQTLQKSGGE
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 8-157 (1-162), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | E |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 8-158 (1-162), 1.00 |
| auth_asym_id | B |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 8-158 (1-162), 1.00 |
| auth_asym_id | C |
| label_asym_ids of heme | K |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 8-158 (1-162), 1.00 |
| auth_asym_id | D |
| label_asym_ids of heme | L |
| Available structure | PDB |