Danish

Uniprot ID: Q54450

Protein: Hemophore HasA
Organism:
Length: 188
Sequence:

MAFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATAVGVQHADSPELLAA

Number of chains: 12

PDB ID: 1dk0 , Chain A
Resolution	1.77 Å
Residue indices (Uniprot), coverage	2-174 (1-188), 1.00
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 1dk0 , Chain B
Resolution	1.77 Å
Residue indices (Uniprot), coverage	2-174 (1-188), 1.00
auth_asym_id	B
label_asym_ids of heme	D
Available structure	PDB

PDB ID: 1b2v , Chain A
Resolution	1.90 Å
Residue indices (Uniprot), coverage	2-174 (1-188), 1.00
auth_asym_id	A
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 2cn4 , Chain A
Resolution	2.30 Å
Residue indices (Uniprot), coverage	2-174 (2-174), 0.92
auth_asym_id	A
label_asym_ids of heme	C , E
Available structure	PDB

PDB ID: 2cn4 , Chain B
Resolution	2.30 Å
Residue indices (Uniprot), coverage	2-174 (2-174), 0.92
auth_asym_id	B
label_asym_ids of heme	C , E
Available structure	PDB

PDB ID: 2uyd , Chain A
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-174 (1-188), 1.00
auth_asym_id	X
label_asym_ids of heme	B
Available structure	PDB

PDB ID: 3csl , Chain C
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-173 (2-188), 0.99
Difference from Uniprot sequence	expression tag
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	None
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 3csl , Chain D
Resolution	2.70 Å
Residue indices (Uniprot), coverage	1-173 (2-188), 0.99
Difference from Uniprot sequence	expression tag
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	None
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 5c58 , Chain B
Resolution	2.80 Å
Residue indices (Uniprot), coverage	2-174 (2-188), 0.99
Difference from Uniprot sequence	expression tag:initiating methionine
auth_asym_id	B
label_asym_ids of heme	C
Available structure	PDB

PDB ID: 3ddr , Chain C
Resolution	2.80 Å
Residue indices (Uniprot), coverage	1-174 (2-188), 0.99
Difference from Uniprot sequence	expression tag
auth_asym_id	C
Structural gaps	Exists
label_asym_ids of heme	M
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 3ddr , Chain D
Resolution	2.80 Å
Residue indices (Uniprot), coverage	1-174 (2-188), 0.99
Difference from Uniprot sequence	expression tag
auth_asym_id	D
Structural gaps	Exists
label_asym_ids of heme	N
Available structure	PDB and Modeled
RMSD of modeled structure from PDB structure	0.12 Å

PDB ID: 1dkh , Chain A
Resolution	3.20 Å
Residue indices (Uniprot), coverage	3-174 (1-188), 1.00
auth_asym_id	A
label_asym_ids of heme	F
Available structure	PDB