Danish
Uniprot ID:  Q54450
  • Protein: Hemophore HasA
  • Organism: Serratia marcescens
  • Length: 188
  • Sequence:
    • MAFSVNYDSSFGGYSIHDYLGQWASTFGDVNHTNGNVTDANSGGFYGGSLSGSQYAISSTANQVTAFVAGGNLTYTLFNEPAHTLYGQLDSLSFGDGLSGGDTSPYSIQVPDVSFGGLNLSSLQAQGHDGVVHQVVYGLMSGDTGALETALNGILDDYGLSVNSTFDQVAAATAVGVQHADSPELLAA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  14
PDB ID:  pdb_00009xpd , Chain A 
Resolution 1.22 Å
Residue indices (Uniprot), coverage 2-173 (1-176), 0.94
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F11L, G12D, G13N, Y14L, S15T, I16L, H17Q, D18E, Y19F, L20F, G21N, Q22E, S25A, T26S, S58T, A61K, N62D, Q63G, Q88T, S93A, D96N, D102S, T103S, S104T, Q109T, V110E, D112Q, V113F, S114R, F115L, N119G, L120W, S121T, L123E, Q124I, A125S, Q126E, T144S, G145T, A146P, E148L, T149Q, G153N, I154Q, D156Q, D157Q, V162T, D167M, Q168E, V169I, A170R
Insertions None
Deletions V177-A188
Sequence identity to UniProt 0.7102
auth_asym_id A
label_asym_ids of heme E
Available structure PDB
PDB ID:  pdb_00001dk0 , Chain A 
Resolution 1.77 Å
Residue indices (Uniprot), coverage 2-174 (1-188), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001dk0 , Chain B 
Resolution 1.77 Å
Residue indices (Uniprot), coverage 2-174 (1-188), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB
PDB ID:  pdb_00001b2v , Chain A 
Resolution 1.90 Å
Residue indices (Uniprot), coverage 2-174 (1-188), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00009xpi , Chain A 
Resolution 2.16 Å
Residue indices (Uniprot), coverage 1-175 (1-176), 0.94
Difference from Uniprot sequence engineered mutation
Mutations (UniProt numbering) F11L, G12A, G13N, Y14L, S15T, I16L, H17A, D18E, Y19F, L20F, G21N, Q22E, T26Y, N41S, S58T, A61K, N62D, Q63G, N79S, E80P, Q88T, S91A, S93T, D96N, T103S, S104T, Q109V, V110N, D112E, S114T, G116S, L120W, S121T, L123E, A125E, Q126E, Q134K, V136I, G145T, E148L, T149Q, G153S, I154L, D156K, D157Q, V162I, Q168E, V169I
Insertions None
Deletions V177-A188
Sequence identity to UniProt 0.7273
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00002cn4 , Chain A 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 2-174 (2-174), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1, A174-A187
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme E ,  C
Available structure PDB
PDB ID:  pdb_00002cn4 , Chain B 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 2-174 (2-174), 0.92
Mutations (UniProt numbering) None
Insertions None
Deletions M1, A174-A187
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme E ,  C
Available structure PDB
PDB ID:  pdb_00002uyd , Chain A 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-174 (1-188), 1.00
Mutations (UniProt numbering) H83A
Insertions None
Deletions None
Sequence identity to UniProt 0.9947
auth_asym_id X
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00003csl , Chain C 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-173 (2-188), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 1insRGSHHHHHHGIRMRARYP
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 29ASP-38THR
Structural gaps Exists
label_asym_ids of heme None
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.09 Å
PDB ID:  pdb_00003csl , Chain D 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 1-173 (2-188), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 1insRGSHHHHHHGIRMRARYP
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 29ASP-38THR
Structural gaps Exists
label_asym_ids of heme None
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.12 Å
PDB ID:  pdb_00005c58 , Chain B 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 2-174 (2-188), 1.00
Difference from Uniprot sequence expression tag:initiating methionine
Mutations (UniProt numbering) None
Insertions 1insRGSHHHHHHGIRMRARYP
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00003ddr , Chain C 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-174 (2-188), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 1insRGSHHHHHHGIRMRARYP
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id C
Missing residues 29ASP-40ALA
Structural gaps Exists
label_asym_ids of heme M
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.10 Å
PDB ID:  pdb_00003ddr , Chain D 
Resolution 2.80 Å
Residue indices (Uniprot), coverage 1-174 (2-188), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 1insRGSHHHHHHGIRMRARYP
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id D
Missing residues 29ASP-40ALA
Structural gaps Exists
label_asym_ids of heme N
Available structure PDB and Modeled
RMSD of experimental residues after energy minimization 0.11 Å
PDB ID:  pdb_00001dkh , Chain A 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 3-174 (1-188), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme F
Available structure PDB