Danish
Uniprot ID:  Q556V8
  • Protein: Dyp-type peroxidase family protein
  • Organism: Social amoeba (Dictyostelium discoideum)
  • Length: 306
  • Sequence:
    • MAQSTVLPMHCLYGIFLEGNLKIQKNDQEGLKKFKDNIKKFTLELDEIDKISPQSRIGGAICFSSDIWDTVTKKISKPKELKSVNTLSSYMPGTSQRDILIHIISDRMDTCFKLAQDTMRNFGEDQLDIKQEIHGFRRVEERDLTDFIDGTENPDGDELRTQYGLVAAGQPNEFGSYVFTQRYVHNLKKWYPEPLSVQQDTVGRTKKDSIEIPRDKRPITSHVSRTDLSENGKDLKIVRQSLPYGQITGEKGLMFIAYACSLHNIEKQLQSMFGQLDGKHDLLLKYTTPVTGSFYFAPSKKELLEL
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  8
PDB ID:  pdb_00007odz , Chain A 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 0-306 (1-306), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insGPLGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007odz , Chain B 
Resolution 1.60 Å
Residue indices (Uniprot), coverage 0-306 (1-306), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insGPLGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme J
Available structure PDB
PDB ID:  pdb_00007o9j , Chain A 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 1-306 (1-306), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insGPLGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007o9j , Chain B 
Resolution 1.70 Å
Residue indices (Uniprot), coverage 0-306 (1-306), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insGPLGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00007o9l , Chain A 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-306 (1-306), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insGPLGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00007o9l , Chain B 
Resolution 1.85 Å
Residue indices (Uniprot), coverage 1-306 (1-306), 1.00
Difference from Uniprot sequence expression tag
Mutations (UniProt numbering) None
Insertions 0insGPLGS
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme I
Available structure PDB
PDB ID:  pdb_00008ohy , Chain A 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 1-306 (1-306), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00008ohy , Chain A-1 
Resolution 1.95 Å
Residue indices (Uniprot), coverage 1-306 (1-306), 1.00
Mutations (UniProt numbering) None
Insertions None
Deletions None
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C-1
Available structure PDB