- Protein: Dyp-type peroxidase family protein
- Organism: Social amoeba (Dictyostelium discoideum)
- Length: 306
- Sequence:
MAQSTVLPMHCLYGIFLEGNLKIQKNDQEGLKKFKDNIKKFTLELDEIDKISPQSRIGGAICFSSDIWDTVTKKISKPKELKSVNTLSSYMPGTSQRDILIHIISDRMDTCFKLAQDTMRNFGEDQLDIKQEIHGFRRVEERDLTDFIDGTENPDGDELRTQYGLVAAGQPNEFGSYVFTQRYVHNLKKWYPEPLSVQQDTVGRTKKDSIEIPRDKRPITSHVSRTDLSENGKDLKIVRQSLPYGQITGEKGLMFIAYACSLHNIEKQLQSMFGQLDGKHDLLLKYTTPVTGSFYFAPSKKELLEL
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-306 (1-306), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.60 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-306 (1-306), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | J |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-306 (1-306), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 0-306 (1-306), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.85 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-306 (1-306), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.85 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-306 (1-306), 1.00 |
| Difference from Uniprot sequence | expression tag |
| auth_asym_id | B |
| label_asym_ids of heme | I |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-306 (1-306), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 1.95 Å |
|---|---|
| Residue indices (Uniprot), coverage | 1-306 (1-306), 1.00 |
| auth_asym_id | A |
| label_asym_ids of heme | C-1 |
| Available structure | PDB |