- Protein: Nitric oxide reductase subunit C
- Organism:
- Length: 146
- Sequence:
MSETFTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAMSAAVVRGKLVWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMNIQPLNVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 5-146 (1-146), 1.00 |
| auth_asym_id | C |
| label_asym_ids of heme | L |
| Available structure | PDB |
| Resolution | 2.49 Å |
|---|---|
| Residue indices (Uniprot), coverage | 5-146 (1-146), 1.00 |
| auth_asym_id | C |
| label_asym_ids of heme | M |
| Available structure | PDB |
| Resolution | 2.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 5-146 (1-146), 1.00 |
| auth_asym_id | C |
| label_asym_ids of heme | M |
| Available structure | PDB |
| Resolution | 2.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 5-146 (1-146), 1.00 |
| auth_asym_id | C |
| label_asym_ids of heme | J |
| Available structure | PDB |
| Resolution | 2.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 5-146 (1-146), 1.00 |
| auth_asym_id | C |
| label_asym_ids of heme | J |
| Available structure | PDB |
| Resolution | 3.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 5-146 (1-146), 1.00 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | A |
| label_asym_ids of heme | G |
| Available structure | PDB |
| Resolution | 3.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 5-146 (1-146), 1.00 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | C |
| label_asym_ids of heme | N |
| Available structure | PDB |
| Resolution | 3.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 5-146 (1-146), 1.00 |
| auth_asym_id | C |
| label_asym_ids of heme | S |
| Available structure | PDB |