- Protein: Nitric oxide reductase subunit B
- Organism:
- Length: 466
- Sequence:
MMSPNGSLKFASQAVAKPYFVFALILFVGQILFGLIMGLQYVVGDFLFPAIPFNVARMVHTNLLIVWLLFGFMGAAYYLVPEESDCELYSPKLAWILFWVFAAAGVLTILGYLLVPYAGLARLTGNELWPTMGREFLEQPTISKAGIVIVALGFLFNVGMTVLRGRKTAISMVLMTGLIGLALLFLFSFYNPENLTRDKFYWWWVVHLWVEGVWELIMGAILAFVLVKITGVDREVIEKWLYVIIAMALISGIIGTGHHYFWIGVPGYWLWLGSVFSALEPLPFFAMVLFAFNTINRRRRRDYPNRAVALWAMGTTVMAFLGAGVWGFMHTLAPVNYYTHGTQLTAAHGHMAFYGAYAMIVMTIISYAMPRLRGIGEAMDNRSQVLEMWGFWLMTVAMVFITLFLSAAGVLQVWLQRMPADGAAMTFMATQDQLAIFYWLREGAGVVFLIGLVAYLLSFRRGKAAA
| Resolution | 2.30 Å |
|---|---|
| Residue indices (Uniprot), coverage | 10-458 (1-466), 1.00 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | E , F |
| Available structure | PDB |
| Resolution | 2.49 Å |
|---|---|
| Residue indices (Uniprot), coverage | 10-458 (1-466), 1.00 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | E , F |
| Available structure | PDB |
| Resolution | 2.50 Å |
|---|---|
| Residue indices (Uniprot), coverage | 10-458 (1-466), 1.00 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | E , F |
| Available structure | PDB |
| Resolution | 2.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 10-458 (1-466), 1.00 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | E , F |
| Available structure | PDB |
| Resolution | 2.70 Å |
|---|---|
| Residue indices (Uniprot), coverage | 10-458 (1-466), 1.00 |
| Difference from Uniprot sequence | conflict |
| auth_asym_id | B |
| label_asym_ids of heme | E , F |
| Available structure | PDB |
| Resolution | 3.20 Å |
|---|---|
| Residue indices (Uniprot), coverage | 10-458 (1-466), 1.00 |
| Difference from Uniprot sequence | deletion |
| auth_asym_id | B |
| label_asym_ids of heme | J , K |
| Available structure | PDB |