Danish
Uniprot ID:  Q59647
  • Protein: Nitric oxide reductase subunit B
  • Organism: Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1)
  • Length: 466
  • Sequence:
    • MMSPNGSLKFASQAVAKPYFVFALILFVGQILFGLIMGLQYVVGDFLFPAIPFNVARMVHTNLLIVWLLFGFMGAAYYLVPEESDCELYSPKLAWILFWVFAAAGVLTILGYLLVPYAGLARLTGNELWPTMGREFLEQPTISKAGIVIVALGFLFNVGMTVLRGRKTAISMVLMTGLIGLALLFLFSFYNPENLTRDKFYWWWVVHLWVEGVWELIMGAILAFVLVKITGVDREVIEKWLYVIIAMALISGIIGTGHHYFWIGVPGYWLWLGSVFSALEPLPFFAMVLFAFNTINRRRRRDYPNRAVALWAMGTTVMAFLGAGVWGFMHTLAPVNYYTHGTQLTAAHGHMAFYGAYAMIVMTIISYAMPRLRGIGEAMDNRSQVLEMWGFWLMTVAMVFITLFLSAAGVLQVWLQRMPADGAAMTFMATQDQLAIFYWLREGAGVVFLIGLVAYLLSFRRGKAAA
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  8
PDB ID:  pdb_00003wfd , Chain C 
Resolution 2.30 Å
Residue indices (Uniprot), coverage 10-458 (1-466), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) None
Insertions None
Deletions R297
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F ,  E
Available structure PDB
PDB ID:  pdb_00003wfe , Chain C 
Resolution 2.49 Å
Residue indices (Uniprot), coverage 10-458 (1-466), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) None
Insertions None
Deletions R297
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F ,  E
Available structure PDB
PDB ID:  pdb_00003wfc , Chain C 
Resolution 2.50 Å
Residue indices (Uniprot), coverage 10-458 (1-466), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) None
Insertions None
Deletions R297
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F ,  E
Available structure PDB
PDB ID:  pdb_00003o0r , Chain C 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 10-458 (1-466), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) None
Insertions None
Deletions R297
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F ,  E
Available structure PDB
PDB ID:  pdb_00003wfb , Chain C 
Resolution 2.70 Å
Residue indices (Uniprot), coverage 10-458 (1-466), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) None
Insertions None
Deletions R297
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F ,  E
Available structure PDB
PDB ID:  pdb_00005guw , Chain B 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 10-458 (1-466), 1.00
Difference from Uniprot sequence deletion
Mutations (UniProt numbering) None
Insertions None
Deletions R297
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme K ,  J
Available structure PDB
PDB ID:  pdb_00005guw , Chain D 
Resolution 3.20 Å
Residue indices (Uniprot), coverage 10-458 (1-466), 1.00
Difference from Uniprot sequence deletion
Mutations (UniProt numbering) None
Insertions None
Deletions R297
Sequence identity to UniProt 1.0000
auth_asym_id D
label_asym_ids of heme R ,  Q
Available structure PDB
PDB ID:  pdb_00005gux , Chain C 
Resolution 3.30 Å
Residue indices (Uniprot), coverage 10-458 (1-466), 1.00
Difference from Uniprot sequence conflict
Mutations (UniProt numbering) None
Insertions None
Deletions R297
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme F ,  E
Available structure PDB