Danish
Uniprot ID:  Q5SME3
  • Protein: Cytochrome c-552
  • Organism: Thermus thermophilus (strain ATCC 27634 / DSM 579 / HB8)
  • Length: 148
  • Sequence:
    • MKRTLMAFLLLGGLALAQADGAKIYAQCAGCHQQNGQGIPGAFPPLAGHVAEILAKEGGREYLILVLLYGLQGQIEVKGMKYNGVMSSFAQLKDEEIAAVLNHIATAWGDAKKVKGFKPFTAEEVKKLRAKKLTPQQVLAERKKLGLK
Exclude chains with
Mutations (vs. UniProt)
Clear
Number of chains:  3
PDB ID:  pdb_00001dt1 , Chain A 
Resolution 1.80 Å
Residue indices (Uniprot), coverage 3-131 (20-148), 0.87
Mutations (UniProt numbering) None
Insertions None
Deletions M1-A19
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme B
Available structure PDB
PDB ID:  pdb_00001foc , Chain A 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 4-131 (17-148), 0.89
Mutations (UniProt numbering) None
Insertions None
Deletions M1-L16
Sequence identity to UniProt 1.0000
auth_asym_id A
label_asym_ids of heme C
Available structure PDB
PDB ID:  pdb_00001foc , Chain B 
Resolution 3.00 Å
Residue indices (Uniprot), coverage 4-131 (17-148), 0.89
Mutations (UniProt numbering) None
Insertions None
Deletions M1-L16
Sequence identity to UniProt 1.0000
auth_asym_id B
label_asym_ids of heme D
Available structure PDB