- Protein: Cytochrome c-552
- Organism:
- Length: 148
- Sequence:
MKRTLMAFLLLGGLALAQADGAKIYAQCAGCHQQNGQGIPGAFPPLAGHVAEILAKEGGREYLILVLLYGLQGQIEVKGMKYNGVMSSFAQLKDEEIAAVLNHIATAWGDAKKVKGFKPFTAEEVKKLRAKKLTPQQVLAERKKLGLK
| Resolution | 1.80 Å |
|---|---|
| Residue indices (Uniprot), coverage | 3-131 (20-148), 0.87 |
| auth_asym_id | A |
| label_asym_ids of heme | B |
| Available structure | PDB |
| Resolution | 3.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-131 (17-148), 0.89 |
| auth_asym_id | A |
| label_asym_ids of heme | C |
| Available structure | PDB |
| Resolution | 3.00 Å |
|---|---|
| Residue indices (Uniprot), coverage | 4-131 (17-148), 0.89 |
| auth_asym_id | B |
| label_asym_ids of heme | D |
| Available structure | PDB |